National Library of Energy BETA

Sample records for 202-512-2104 mail superintendent

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  3. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  6. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  8. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  9. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  10. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  11. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  12. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  13. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  14. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  15. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  16. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  17. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  18. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  19. I United States Government Printing Office SUPERINTENDENT OF WCUMENTS

    Office of Legacy Management (LM)

    onSree;sional atecord I United States Government Printing Office SUPERINTENDENT OF WCUMENTS Wash~ngtm. D.C 20402 OFFEIAL BUSINESS Penalty for prwate use. 9300 Congressmnal Record (USPS 087-390) United States of America . :- PROCEEDINGS AND DEBATES OF THE 98' hCONGRESS, FIRST SESSION 0 * U.S -C3 Postage and Fees Pad U S Governme3n7t5Prmt~ng Office SECOND CLASS NEWSPAPER H-4578 ' CQNGRESSIONAL RECORD - HOUSE June 28, 1983 I H.J. Res. 273: Mr. BOLAND, Mr. WAXMAN, Mr. Oeeasrrk. Mr. BEDELL. Mr. BONER

  20. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  1. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  2. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  3. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  4. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  5. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  6. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  7. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  8. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  9. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  14. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  17. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  18. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  19. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  20. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  1. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  2. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  3. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  4. This publication is available from the Superintendent of Documents, U.S. Governm

    Gasoline and Diesel Fuel Update (EIA)

    (GPO). Informa tion about purchasing this or other Energy Information Administration (EIA) publications may be obtained from the GPO or the ElA's National Energy Information Center (NEIC). Questions on energy statistics should be directed to the NEIC by mail, telephone or telecommunications device for the deaf (TDD). Addresses, telephone numbers and hours appear below. National Energy Information Center, El-231 Energy Information Administration Forrestal Building, Room 1F-048 Washington, DC

  5. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  6. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  7. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  9. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  10. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  11. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  12. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  13. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  14. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  15. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  16. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  17. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  18. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  19. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  20. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  1. I REMARKS ON THE TOPOLOGY OF GAUGE FIELDS*

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    » ; * * " \ ) I O O l i n O A O U 3 N 3 9 6 6 L I M d v This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Telephone orders may be directed to: Superintendent of Documents U.S. Government Printing Office Main Order Desk (202)512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing Office P.O. Box

  2. NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661

    Gasoline and Diesel Fuel Update (EIA)

    61- NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. AH telephone orders should be directed to: U.S. Government Printing Office McPherson Square Bookstore 1510 H Street, N.W. Washington, DC 20005 (202)653-2050 FAX (202)376-5055 9 a.m. to 5 p.m., eastern time, M-F All mail orders should be directed to: Superintendent of Documents U.S.

  3. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  4. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  5. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  6. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  7. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  8. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  9. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  10. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  12. DOE/EIA-0202(89/2Q)

    Gasoline and Diesel Fuel Update (EIA)

    2Q) 11989 SHORT-TERM t . t QUARTERLY PROJECTIONS ENERGY INFORMATION ADMINISTRATION This publication is available from the Superintendent of Documents, U.S. Government Printing Office (GPO). Informa tion about purchasing this or other Energy Information Administration (EIA) publications may be obtained from the GPO or the ElA's National Energy Information Center (NEIC). Questions on energy statistics should be directed to the NEIC by mail, telephone or telecommunications device for the deaf

  13. DOE/EIA-0202(89/4Q) SHOKT-TERM

    Gasoline and Diesel Fuel Update (EIA)

    4Q) SHOKT-TERM t . t QUARTERLY PROJECTIONS This publication is available from the Superintendent of Documents, U.S. Government Printing Office (QPO). Informa tion about purchasing this or other Energy Information Administration (EIA) publications may be obtained from the GPO or the ElA's National Energy Information Center (NEIC). Questions on energy statistics should be directed to the NEIC by mail, telephone or telecommunications device for the deaf (TDD). Addresses, telephone numbers and hours

  14. DOE/EIA-0202(90/2Q) SHOET-TERM QUARTERLY PROJECTIONS

    Gasoline and Diesel Fuel Update (EIA)

    0/2Q) SHOET-TERM QUARTERLY PROJECTIONS This publication may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Purchasing in formation for this or other Energy Information Administration (EIA) publications may be obtained from the Government Printing Office or ElA's National Energy Information Center. Questions on energy statistics should be directed to the Center by mail, telephone, or telecommunications device for the hearing impaired. Addresses, telephone

  15. Subscribe Today to E-mail Alerts from GTO

    Broader source: Energy.gov [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  16. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  17. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  18. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Interactions.org Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  19. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  20. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  1. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  2. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  3. This publication is available from the Superintendent of Documents, U.S. Governm

    Gasoline and Diesel Fuel Update (EIA)

    Donald L. Paul Executive Director, USC Energy Institute and William M. Keck Chair of Energy Resources 06 April 2010 EIA and SAIS 2010 Energy Conference Energy and the Economy Technology and Energy Transformation Science and Technology + Economics and Business + Society and Environment + Policy and Government Scale, time, and complexity 3 Existing supply and demand infrastructure New resources, infrastructures, and paradigms Multiple generations of technology History, the present, and the future

  4. NOIlVyiSINIIAIQV AOd3N3 AO^HNH

    Gasoline and Diesel Fuel Update (EIA)

    NOIlVyiSINIIAIQV AOd3N3 AO^HNH 0661 (Oe/06)2020-VI3/3Oa This publication may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Purchasing in formation for this or other Energy Information Administration (EIA) publications may be obtained from the Government Printing Office or ElA's National Energy Information Center. Questions on energy statistics should be directed to the Center by mail, telephone, or telecommunications device for the hearing impaired.

  5. QUARTER SH OR T-T ER M EN ER GY OU TL OO K QUAR TERL Y PROJ

    Gasoline and Diesel Fuel Update (EIA)

    1 2 QUARTER SH OR T-T ER M EN ER GY OU TL OO K QUAR TERL Y PROJ ECTIO NS ENERGY INFORMA TION ADMINIST RATION May 1991 This publication may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Purchasing in formation for this or other Energy Information Administration (EIA) publications may be obtained from the Government Printing Office or ElA's National Energy Information Center. Questions on energy statistics should be directed to the Center by mail, telephone,

  6. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com. Email from either site may also be in this form: xxx@cns.doe.gov. * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  7. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12: xxx@y12.doe.gov, for Pantex: xxx@pantex.com.  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  8. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...

  9. CERTIFIED MAIL RETURN RECEIPT REQUESTED Dr. Chi-Chang Kao Laboratory...

    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  10. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  11. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  12. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  13. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    ...leod@pnso.science.doe.gov Sandia Site Office Dave Ferguson Dave.Ferguson@nnsa.doe.gov Savannah River Site Office Carol Elliot carol.elliott@nnsa.srs.gov Y-12 Site Office Jill ...

  14. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  15. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  16. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  17. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones

    2012-12-01

    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  18. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  19. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  20. U Plant Ancillary Facility Demolition A Department of Energy Recovery Act Project

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    O P J I S W J I U P V U O I 1 E W J O J U I A 6 J 9 U 3 o i i o 3 r o a d n \ > ! 0 0 1 i n O A O U 3 N 3 U U 3 J . - ) J O l | S Ordering Information This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office U.S Government Printing Office P.O. Box 371954 Pittsburgh, PA 15250-7954 By Phone: By Mail: U.S. Government Printing Office Main Bookstore 71 ON. Capitol Street, NW Washington, DC

  1. Solar Installation Contractor

    Broader source: Energy.gov [DOE]

    Alternate Title(s):General Contractor, Electrical or Plumbing Contractor, Construction Manager, Project Superintendant

  2. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)

    2009-12-21

    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Silverstein, Eva (1) Smith, Kendrick M., E-mail: siavoshrezvan@gmail.com, E-mail: ... Mirbabayi, Mehrdad ; Senatore, Leonardo ; Smith, Kendrick M., E-mail: ...

  4. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Enhancement in magnetic properties of magnesium substituted bismuth ferrite nanoparticles Xu, Jianlong ; Xie, Dan, E-mail: xiedan@mail.tsinghua.edu.cn, E-mail: ...

  5. Hyekyung Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hyekyung Kim Hyekyung Kim Postdoctoral Appointee E-mail clarisse

  6. Osman Eryilmaz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Osman Eryilmaz Principal Materials Scientist E-mail eryilmaz

  7. Balendra Sutharshan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Balendra Sutharshan Chief Operations Officer - EGS E-mail bsutharshan

  8. Ryne T. Willig | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ryne T. Willig Safety Associate - EGS E-mail rwillig

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ... macintosh1@llnl.gov, E-mail: jaisaacs@wisc.edu, E-mail: artie@tls-tautenburg.de, ...

  10. Robotics program gets boost from $10,000 donation | National...

    National Nuclear Security Administration (NNSA)

    NNSA Blog About the photo: Don Wood (left), Bushland ISD Superintendent, discusses how the CNS donation will help the Bushland robotics program with Savannah Gates, a CNS Pantex ...

  11. Final Report - SPRU Type B Accident Investigation Report

    Office of Environmental Management (EM)

    ... Integrated Safety Management Guiding Principles ... Technician WS Waste Superintendent v Acronyms ALARA as low as reasonably ...2010 "Demo Ready Checklist" signed off in ...

  12. PNOV NEA-2011-04

    Office of Environmental Management (EM)

    ... Severity Level III violations are less serious but are ... which requires compliance with those QA criteria. ... radiation protection management, waste superintendent, and SPRU ...

  13. QUARTER SHORT-TERM ENERGY OUTLOOK QUARTERLY PROJECTIONS ENERGY...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    1Q) 1991 1 QUARTER SHORT-TERM ENERGY OUTLOOK QUARTERLY PROJECTIONS ENERGY INFORMATION ADMINISTRATION February 1991 This publication may be purchased from the Superintendent of ...

  14. Tim Kuneli, Electronics Maintenance Group

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tim Kuneli, Electronics Maintenance Group Print The recent ALS power supply failure was one of the most challenging projects that Electronics Engineer Technical Superintendent Tim...

  15. Better Buildings Neighborhood Program

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... * Contest held * Neighborhood meetings * Contest had participants * Social media * Direct mail * Social media applications * Direct mail resulted in applications * Telethon ...

  16. Desmond Toa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Desmond Toa Desmond Toa Desmond Toa Graduate Student E-mail: desmond.toa@mail.utoronto.ca Website: Princeton University

  17. Undergraduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Undergraduate Students Undergraduate Students Ingrid Archibald Undergraduate Student E-mail: ingridarchibald@wustl.edu Divya Babbula Undergraduate Student E-mail: divya.babbula@wustl.edu Stephanie Botkin E-mail: stephanie.botkin@wustl.edu Kyle Cepeda Undergraduate Student E-mail: kcepeda@wustl.edu Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Ryan Farhat-Sabet Undergraduate Student E-mail: r.farhat-sabet@wustl.edu Caroline Focht Undergraduate Student E-mail:

  18. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  19. Evaluation of the exothermicity of the chemi-ionization reaction...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cox, Richard M ; Kim, JungSoo ; Armentrout, P. B., E-mail: armentrout@chem.utah.edu, E-mail: mheaven@emory.edu, E-mail: albert.viggiano@us.af.mil 1 ; Bartlett, Joshua ; ...

  20. Laboratory Equipment Donation Program - Administrative Login

    Office of Scientific and Technical Information (OSTI)

    Logon Reset Forgot your username or password or need to change your e-mail address? Send e-mail to pf-lepd@osti.gov. Need to change OPMO contact (i.e., e-mail, name, telephone ...

  1. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)

    None

    2012-12-31

    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  2. EERE Publication and Product Library

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Requests You have not requested any products. You can request that products and publications be mailed to you by clicking on the "Request by Mail" link in the publication...

  3. Sandia National Laboratories: Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us New Mexico California Sandia National Laboratories, New Mexico P.O. Box 5800 Albuquerque, NM 87185-(mail stop)* Non-mail deliveries: 1515 Eubank SE Albuquerque, NM 87123 Sandia National Laboratories, California P.O. Box 969 Livermore, CA 94551-0969 Non-mail deliveries: 7011 East Avenue Livermore, CA 94550 * All mail must contain an appropriate mail stop to ensure delivery. For employee mail stops, reference our Employee Locator. Contact Information General Inquiries New

  4. My Account | Critical Materials Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    My Account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  5. User account | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User account User account Primary tabs Log in Request new password(active tab) Username or e-mail address * E-mail new password

  6. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  7. Bryan Fry | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bryan Fry Bryan Fry Bryan Fry Graduate Student E-mail: bryanfry@mail.med.upenn.edu Website: University of Pennsylvania Graduate...

  8. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Anzai, Jun, E-mail: anzaijun@kaken.co.jp Pharmacology Department, Central Research ... Asano, Taiji, E-mail: asanotaiji@kaken.co.jp Pharmacology Department, Central Research ...

  9. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  10. Research and Technical Associates | Photosynthetic Antenna Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    placeholder image Amy LaFountain Research Affiliate Technical Assocaite E-mail: amy.lafountain@uconn.edu Graham Leggett Graham Leggett Professor E-mail:...

  11. Green Supers Graduate Prepared to Make NYC More Energy Efficient

    Broader source: Energy.gov [DOE]

    Secretary Chu delivered the graduation address for the Green Supers program in New York City. The 40-hour program teaches building superintendents everything they need to know about green building operations and maintenance.

  12. Y-12 apprentice programs through the years

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and 1990-1992. The last apprentice program before the current one began in 2008. Paul Norris, a retired Plant Shift Superintendent, during a recent Oral History video interview, ...

  13. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    2 READING FILE COPY 4 4 1 *4 4 4rr 4 4 4rr 4L 4 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of...

  14. Energy Information Administration Petroleum

    U.S. Energy Information Administration (EIA) Indexed Site

    252-8800 Superintendent of Documents U.S. Government Printing Office Washington, DC 20402 (202) 783-3238 Released for Printing December 16, 1986 *0- % ADOEIEIA-0487(85)I1 f ,...

  15. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    Government Printing Office Farragut Bookstore 1510 H Street, NW Washington, DC 20005 (202) 653-2050 FAX (202) 376-5055 9 a.m. to 5 p.m., eastern time, M-F Superintendent of...

  16. Document

    National Nuclear Security Administration (NNSA)

    The Code of Federal Regulations is sold by the Superintendent of Documents. Prices of new books are listed in the first FEDERAL REGISTER issue of each week. Rules and Regulations ...

  17. 1 of 8

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a consumer assistance program can help you file your appeal. Contact the New Mexico Superintendent of Insurance toll-free at 1-855-427-5674 or www.osi.state.nm.us. 6...

  18. Paducah Site Interns Learn About EM Opportunities | Department of Energy

    Energy Savers [EERE]

    Interns Learn About EM Opportunities Paducah Site Interns Learn About EM Opportunities August 28, 2014 - 12:00pm Addthis LATA Kentucky groundwater cleanup site superintendent Donnie Bell, far right, describes the project to (from left) Steve Christmas of LATA Kentucky and interns Weston Loyd, Matthew Jehnke, and Wesley Morgan. LATA Kentucky groundwater cleanup site superintendent Donnie Bell, far right, describes the project to (from left) Steve Christmas of LATA Kentucky and interns Weston

  19. DOE/EIA-0318/1 Nonresidential Buildings Energy Consumption Survey:

    U.S. Energy Information Administration (EIA) Indexed Site

    318/1 Nonresidential Buildings Energy Consumption Survey: 1979 Consumption and Expenditures D! Part I: Natural Gas and Electricity March 1983 Energy Information Administration Washington, D.C. 1111? This publication is available from the Superintendent of Documents, U.S. Government Printing Office |GPO). Make check or money order payable to the Superintendent of Documents. You may send your order to the U.S. Government Printing Office or the National Energy Information Center. GPO prices are

  20. Eric Rask | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rask Eric Rask Principal Research Engineer E-mail erask@anl.gov

  1. Eugene Stewart | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technician Sr. Eugene Stewart Telephone 630.252.4466 E-mail estewart

  2. Jared Ross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jared Ross Jared Ross Jared Ross Undergraduate Student E-mail: jbross

  3. Hussein S. Khalil | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hussein S. Khalil Nuclear Energy and Security Program Leader - EGS E-mail hkhalil

  4. Todd E. Combs | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Todd E. Combs Interim Associate Laboratory Director - EGS E-mail tcombs

  5. Peter Fuesz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Associate Peter Fuesz Telephone 630.252.7151 E-mail fuesz

  6. William Brocker | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    William Brocker ESH/QA Coordinator - EGS E-mail wbrocker

  7. Youngjin Kim | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Youngjin Kim Postdoctoral Appointee E-mail kimy@anl.gov Projects Distribution Automation

  8. Nicholaos Demas | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Nick Demas Nicholaos Demas Assistant Materials Scientist E-mail ndemas@anl.gov

  9. Edward J. Daniels | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Edward J. Daniels Sr. Energy Systems Scientist Telephone (630) 252-5279 E-mail edaniels

  10. Microsoft Word - Microfabrication Project Proposal Form-April16...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Proposal Form Principle Investigator: (Person responsible for project) Name: E-Mail Address: ...

  11. Ron Tollner | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ron Tollner Manager, Building & Systems Operations Telephone 630.252.4457 E-mail tollner

  12. Nathan Soulier | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nathan Soulier Nathan Soulier Nathan Soulier Graduate Student E-mail: nts116

  13. Susan R. Podoba | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Susan R. Podoba Executive Secretary to the Associate Laboratory Director - EGS E-mail spodoba

  14. A. Scott Dunlop | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. Scott Dunlop National Security Facility Director - EGS E-mail adunlop

  15. Renee M. Nault | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Renee M. Nault Senior Manager, Business Development - EGS E-mail rmnault

  16. Mary A. McIntyre | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A. McIntyre Business Strategist - EGS E-mail mmcintyre

  17. Mary Ellen Hennebry | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ellen Hennebry Assistant to the Associate Laboratory Director - EGS E-mail mehennebry

  18. Scott Goldsborough | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Goldsborough Principal Mechanical Engineer E-mail sgoldsborough@anl.gov Projects Fuel Kinetics

  19. Sharon Nykolyshyn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sharon Nykolyshyn Executive Secretary - EGS Telephone 630-252-3739 E-mail snykolyshyn

  20. David Eckstein | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eckstein Principal Application Developer Telephone 630.252.7918 E-mail deckstein@anl.gov

  1. Denise M. Voss | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Denise M. Voss Executive Secretary to the Chief Operations Officer - EGS E-mail dvoss

  2. Aaron Greco | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aaron Greco Principal Materials Scientist E-mail agreco@anl.gov Website Argonne Experts

  3. Alex Martinson | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alex Martinson Telephone (630) 252-7520 E-mail martinson

  4. Graduate Students | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    People / Graduate Students Graduate Students Sam Barnett Graduate Student E-mail: sbarnett1@sheffield.ac.uk Hui-Yuan Chen Graduate Student E-mail: chen.hui-yuan@wustl.edu Kaitlyn Faries Kaitlyn Faries Graduate Student E-mail: kaitlyn.faries@wustl.edu Phone: 314.935.6566 Kirsty Hacking Graduate Student E-mail: k.hacking.1@research.gla.ac.uk Ming-Yang Ho Graduate Student E-mail: mxh504@psu.edu Don Hood Graduate Student E-mail: dhood@wustl.edu Xia Huang Graduate Student E-mail:

  5. March 2016 APM newsletter | Department of Energy

    Energy Savers [EERE]

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  6. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah

  7. Scientific Advisory Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific Advisory Committee Scientific Advisory Committee Gary Brudvig Scientific Advisory Committee Member E-mail: gary.brudvig@yale.edu J. Clark Lagarias Scientific Advisory Committee Member E-mail: jclagarias@ucdavis.edu Thomas Moore Thomas Moore Scientific Advisory Committee Chair E-mail: tom.moore@asu.edu Phone: 480.965.3308 Jennifer Ogilvie Scientific Advisory Committee Member E-mail: jogilvie@umich.edu Marion Thurnauer Marion Thurnauer Scientific Advisory Committee Member E-mail:

  8. Document

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... E-mail comments must be sent to emilyslistrepeal@fec.gov. If e- mail comments include an attachment, the attachment must be in either Adobe Acrobat (.pdf) or Microsoft Word (.doc) ...

  9. How is a Document Containing OUO Marked? | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with "Document(s) transmitted contain(s) OUO information". (DOE M 471.3-1, Admin Chg 1, Chapter I, 3f.) Marking e-mail: If the e-mail contains OUO information, the first line of ...

  10. How to Submit a Freedom of Information Act Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and the Fax number will change to: (720)356-1780 Email: michele.altieri@go.doe.gov Please clearly mark the mailing envelope, fax or subject line of e-mail "Freedom of ...

  11. Magnetohydrodynamics and deep mixing in evolved stars. I. Two...

    Office of Scientific and Technical Information (OSTI)

    Authors: Nucci, M. C. 1 ; Busso, M., E-mail: mariaclara.nucci@unipg.it, E-mail: busso@fisica.unipg.it 2 + Show Author Affiliations Department of Mathematics and Informatics, ...

  12. Contacts | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    information to contact the State and Local Solution Center by mail or email: U.S. Department of Energy State and Local Solution Center Mail Stop EE-5W 1000 Independence Ave., SW...

  13. Contact Us | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Mail and delivery address information: Y-12 National Security Complex P.O. Box 2009 Oak Ridge, TN 37831-8245* Non-mail deliveries: Bear Creek Road P.O. Box...

  14. Research Affiliates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engel Gregory Engel Research Affiliate E-mail: gsengel@uchicago.edu Phone: 773.834.0818 Harry Frank Harry Frank Research Affiliate E-mail: harry.frank@uconn.edu Phone: 860.486.2844...

  15. Microsoft Word - Document3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ...nancy@mail.house.gov; americanvoices@mail.house.gov; comments@whitehouse.gov; ... THE DESTRUCTION OF MUCH OF THE GULF OF MEXICO. DOE IS SCUM BUSHCHENEY COUNTRY AND HAS ...

  16. People | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Associate Professor, Schulich Faculty of Chemistry Research Affiliate E-mail: nadir@tx.technion.ac.il Phone: 972.4.829.2141 Dan Allen Dan Allen Multimedia Specialist E-mail: ...

  17. Operations Committee | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manager, Research Administration and Operations E-mail: kmosley@wustl.edu Phone: 314-935-3168 Dan Allen Dan Allen Multimedia Specialist E-mail: danallen@wustl.edu Phone: ...

  18. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Fornasini, Maria L., E-mail: cfmet@chimica.unige.i (1) Fornasini, Maria Luisa (1) Manfrinetti, Pietro (1) Manfrinetti, Pietro, E-mail: chimfis@chimica.unige.i (1) ...

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Filter by Author Manfrinetti, P. (2) Fornasini, Maria L., E-mail: cfmet@chimica.unige.i ... Perrone 24, 16152 Genova ; Fornasini, Maria L., E-mail: cfmet@chimica.unige.i Phases ...

  20. Hopping conduction in p-type MoS{sub 2} near the critical regime...

    Office of Scientific and Technical Information (OSTI)

    ; Park, Joonsuk 4 ; Lin, Der-Yuh 5 ; Huang, Ying-Sheng 6 ; Choi, Heon-Jin 7 ; Chang, Joonyeon, E-mail: cujang@kist.re.kr, E-mail: presto@kist.re.kr 1 ; Department of ...

  1. Novel short antibacterial and antifungal peptides with low cytotoxicit...

    Office of Scientific and Technical Information (OSTI)

    Ning Chen, Wei ; Ming Li, Chang ; Xu, Rong 1 ; Lamrani, Mouad 3 ; Mu, Yuguang, E-mail: ygmu@ntu.edu.sg 2 ; Leong, Susanna Su Jan 1 ; Wook Chang, Matthew, E-mail: ...

  2. ALS Beamlines Directory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0.05-1.2 eV This e-mail address is being protected from spambots. You need JavaScript enabled to view it (510) 495-2231 This e-mail address is being protected from...

  3. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read more... Contact: This e-mail address is being protected from spambots. You need JavaScript enabled to view it and This e-mail address is being protected from spambots. You...

  4. Contact Us

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Inquiries: This e-mail address is being protected from spambots. You need JavaScript enabled to view it Proposals: This e-mail address is being protected from spambots....

  5. Postdoctoral Associates | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alastair Gardiner Research Associate E-mail: alastair.gardiner@glasgow.ac.uk Phil Jackson Phil Jackson Postdoctoral Research Associate E-mail: p.j.jackson@sheffield.ac.uk...

  6. Dr.James J.Spivey

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doctoral Researcher Dr. Nitin Kumar E-mail: nkumar2@tigers.lsu.edu Ph.D, 2011, Louisiana State University, Baton Rouge Current Graduate Students Khietlethanh Mai E-mail:...

  7. Subscribe to Energy-Efficient Product Procurement Updates

    Broader source: Energy.gov [DOE]

    FEMP offers e-mail updates covering energy-efficient product procurement requirements, guidance, and assistance. Enter your e-mail address below to begin the registration process. After you...

  8. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... E-mail: jabbari@theory.ipm.ac.ir, E-mail: shiu@physics.wisc.edu The inflationary cosmology paradigm is very successful in explaining the CMB anisotropy to the percent level. ...

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... HISTORY OF THE INTERGALACTIC MEDIUM Cen Renyue ; Chisari, Nora Elisa, E-mail: cen@astro.princeton.edu, E-mail: nchisari@astro.princeton.edu Using the state-of-the-art ...

  10. Contact information | Center for Bio-Inspired Solar Fuel Production

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email: alexander.melkozernov@asu.edu Phone: (480) 965-1548 Fax: (480) 965-5927 Mailing address (US mail): Center for Bio-Inspired Solar Fuel Production Arizona State University ...

  11. BPA-2011-01724-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the following: * An e-mail dated April 5, 2011 from Scott Bettin, BPA biologist, to Philip Key, BPA attorney. This e-mail is referred to in footnote 219 on page 77 of the...

  12. TITLE AUTHORS SUBJECT SUBJECT RELATED DESCRIPTION PUBLISHER AVAILABILI...

    Office of Scientific and Technical Information (OSTI)

    solar neighborhood XXXV Distances to M dwarf systems within PC in the southern sky Winters Jennifer G Jao Wei Chun Dieterich Sergio B E mail winters astro gsu edu E mail jao astro...

  13. DOE - Fossil Energy:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NEWSALERT - Keep Up to date with e-mail alerts from the Office of Fossil Energy Fossil Energy NEWSALERT is a free, e-mail notification service of the U.S. Department of Energy's ...

  14. BPA-2014-00787-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - D-1 Subject: FW: FOIA COE SL-003 BPA JOURNAL MAILING List Kalispell MOA 3-28-2014 Hi Christy and Kim, Pursuant to the FOIA, I request a copy of: 1) The BPA Journal Mailing...

  15. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Chen, Shyan-Shiou, E-mail: sschen@ntnu.edu.tw Department of Mathematics, National Taiwan Normal University, Taipei 11677, Taiwan (China) (2) Chen, Yi-Chiuan, E-mail: YCChen@math....

  16. CONTRACT EMPLOYEES

    National Nuclear Security Administration (NNSA)

    Department Mailing PhoneFax Email or web site California California Department of ... Department Mailing PhoneFax Email or web site New York New York State Division of ...

  17. Acknowledgements of Federal Support | U.S. DOE Office of Science...

    Office of Science (SC) Website

    Peer Reviewed Articles and Technical Papers News Releases, Public-Facing Web, Mailing, and ... Back to Top Back to Top News Releases, Public-Facing Web, Mailing, and Social Media For ...

  18. s-processing in AGB stars revisited. I. Does the main component...

    Office of Scientific and Technical Information (OSTI)

    Authors: Trippella, O. ; Busso, M. 1 ; Maiorca, E. 2 ; Kppeler, F. 3 ; Palmerini, S., E-mail: oscar.trippella@fisica.unipg.it, E-mail: maurizio.busso@fisica.unipg.it 4 + ...

  19. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and e-mails to EIA analysts. In fact, last year an e-mail was circulating around the Internet telling which oil companies imported the most crude oil from Persian Gulf countries...

  20. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Flanagan, anna ., E-mail: sb933@cornell.edu, E-mail: eef3@cornell.edu (1) Save Results Save this search to My Library Excel (limit 2000) CSV (limit 5000) XML (limit 5000) Have ...

  1. Microsoft Word - 4500lnc.dot

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unless changed by holiday. Mail to: Dept. 3651, MS 0165 Fax to: 844-0645 Email: In your Word document, click on FileSend ToMailRecipientclassads@sandia.gov and click on "send."...

  2. GCPCC home

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Prospective users can contact us via e-mail at hbellamyatlsudotedu or call Henry Bellamy at (225) 578- 9342. We continue to offer mail-in crystallography to both...

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Lomaev, Mikhail I. (3) Shao, Tao, E-mail: st@mail.iee.ac.cn (3) Tarasenko, Victor F. (3) ... bimolecular recombination in polymer solar cells Venkatesan, Swaminathan ; Chen, ...

  4. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... All Solution-Processed Lead Halide Perovskite-BiVO 4 Tandem Assembly for Photolytic Solar ... ; Wei, Candong, E-mail: weicando@ipbcams.ac.cn ; Jin, Qi, E-mail: zdsys@vip.sina.com ...

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Mawr, Pennsylvania 19010-2899 ; Mallory, Frank B. ; Rheingold, Arnold L. ; Rotkina, Lolita ; Wang, Xianlong, E-mail: pbeckman@brynmawr.edu, E-mail: wangxianlong@uestc.edu.cn We ...

  6. NOIIVUISINII/UQV NOIlVIAIdOdNI AOH3N3 SNOLL33fOHcI AlHHXHVnO

    Gasoline and Diesel Fuel Update (EIA)

    NOIIVUISINII/UQV NOIlVIAIdOdNI AOH3N3 SNOLL33fOHcI AlHHXHVnO xoonno AOHHNH T €661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. All telephone orders should be directed to: U.S. Government Printing Office Superintendent of Documents McPherson Square Bookstore U.S. Government Printing Office 1510 H Street, N.W. Washington, DC 20402 Washington, DC 20005 (202)783-3238

  7. NOIlVdlSINIWG V NOUVWHOJNI AOH3N SNOUOa

    Gasoline and Diesel Fuel Update (EIA)

    £661. NOIlVdlSINIWG V NOUVWHOJNI AOH3N SNOUOa fOHd )ioo nno AO^H NH £661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. All telephone orders should be directed to: U.S. Government Printing Office Superintendent of Documents McPherson Square Bookstore U.S. Government Printing Office 1510 H Street, N.W. Washington, DC 20402 Washington, DC 20005 (202)783-3238 (202)653-2050 FAX

  8. DOE/EIA-0202(92/2Q)

    Gasoline and Diesel Fuel Update (EIA)

    2Q) 1992 2 QUARTER SHORT-TERM ENERGY OUTLOOK QUARTERLY PROJECTIONS May 1992 This publication and other Energy Information Administration (E1A) publications may be pur chased from the Superintendent of Documents, U.S. Government Printing Office. All telephone orders should be directed to: U.S. Government Printing Office Superintendent of Documents Farragut Bookstore U.S. Government Printing Office 151 OH Street N.W. Washington, DC 20402 Washington, DC 20005 (202)783-3238 (202)653-7697 FAX

  9. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts

  10. C:\Forms\HQ F 1410.8.cdr

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Notification of Incoming Mail Receipt for Incoming Personal Mail Sender Name: Date Processed: Processed by: (Signature and Date of Person Picking up Mail) Employee Name: Routing Symbol: Room Number: Date Received: HQ F 1410.8 (8-84) HQ F 1410.8 (8-84) Date Contacted: MESSAGE To Sender: Mail must be picked up by: or item will be returned to sender. Part 1 Part 2

  11. Link Alpha G

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (EESA) Geophysics Department (EESA) GERT - General Employee Radiological Training (English) Gift Acceptance Information Glenn T. Seaborg Center Gmail (Google Mail)...

  12. Eva Stringer | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Eva Stringer Telephone 630.252.6889 Fax 630.252.4646 E-mail stringer

  13. Jag Kottapalli | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jag Kottapalli Jag Kottapalli Jag Kottapalli Undergraduate Student E-mail: jkottapalli@wustl.edu Website: Washington University Undergraduate Students

  14. Ning Kang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ning Kang Eng Systems Modeling-Simulation-Analysis 2 E-mail nkang@anl.gov Projects Distribution Automation

  15. Nozomi Shirato | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Assistant Physicst Nozomi Shirato Telephone 630.252.3605 Fax 630.252.5739 E-mail nshirato

  16. Cvetelin Vasilev | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Cvetelin Vasilev Postdoctoral Associate E-mail: c.vasilev@sheffield.ac.uk...

  17. Matthew Cuneo | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cuneo Matthew Cuneo Matthew Cuneo Instrument Scientist E-mail: cuneomj@ornl.gov Website: Oak Ridge National Lab...

  18. Jeremy King | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeremy King Jeremy King Jeremy King Graduate Student E-mail: jdking@wustl.edu Website: Washington University Graduate

  19. Joshua Auld | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Auld Joshua Auld Principal Computational Transportation Engineer E-mail jauld@anl.gov Website Profile

  20. Joshua Mancini | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joshua Mancini Joshua Mancini Joshua Mancini Graduate Student E-mail: joshuamancini07@gmail.com Website: University of Pennsylvania

  1. Kathy Vanoskey | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kathy Vanoskey Administrative Secretary Telephone 630.252.4106 Fax 630. 252.6866 E-mail kvanoskey

  2. Kent Bostick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Kent Bostick Kent Bostick Deputy Director of National and Global Security Programs - EGS E-mail kbostick

  3. Khem Acharya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Khem Acharya Khem Acharya Khem Acharya Alumnus E-mail: khem@k-state.edu Website: Kansas State University

  4. H. Larry Collins | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    H. Larry Collins Director, Intelligence Analysis Division E-mail lcollins@anl.gov Projects Counterintelligence National Security Facility...

  5. Nestor J. Zaluzec | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nestor J. Zaluzec Senior Materials Scientist Telephone 630.252.4798 E-mail zaluzec@aaem.amc

  6. Supratik Guha | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supratik Guha NST Division Director Telephone 630.252.7740 Fax 630.252.6866 E-mail sguha

  7. Christine Meyer | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meyer Christine Meyer Christine Meyer Undergraduate Student E-mail: christinemeyer@wustl.edu Website: Washington University Undergraduate Students

  8. Daniel Oblinsky | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Oblinsky Daniel Oblinsky Daniel Oblinsky Graduate Student E-mail: doblinsky@gmail.com Website: Princeton University Graduate Students...

  9. Rachel Mirelez | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administrative Secretary Rachel Mirelez Telephone 630.252.4651 Fax 630.252.6866 E-mail rmirelez

  10. Ravindra Singh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ravindra Singh Eng Systems Modeling-Simulation-Analysis 3 E-mail ravindra.singh@anl.gov Projects Distribution Automation

  11. Stuart Feinberg | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ES&H/QA Coordinator Stuart Feinberg Telephone 630.252.4673 E-mail sfeinberg@anl.gov

  12. Scott Massow | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scott Massow Assistant Facility Manager Telephone 630.252.4620 E-mail smassow@anl.gov

  13. Naryanan (Bobby) Kasthuri | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Neuroscience Researcher Naryanan (Bobby) Kasthuri Telephone 630.252.4966 Fax 630.252.5739 E-mail bobbykasthuri...

  14. Daniel Weisz | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Weisz Daniel Weisz Daniel Weisz Graduate Student E-mail: daweisz@wustl.edu Website: Washington University in St. Louis

  15. Webmaster

    Broader source: Energy.gov [DOE]

    The Bioenergy Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email.

  16. Gaozhong Shen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gaozhong Shen Gaozhong Shen Gaozhong Shen Senior Research Associate E-mail: gxs22@psu.edu Website: Pennsylvania State

  17. Guy Mayneord | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Guy Mayneord Guy Mayneord Guy Mayneord Graduate Student E-mail: gemayneord@sheffield.ac.uk Website: University of Sheffield

  18. Vijaya Subramanian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vijaya Subramanian Vijaya Subramanian placeholder image Vijaya Subramanian Postdoctoral Associate E-mail: vijaya65@hotmail.com Postdoctoral Associates

  19. Audit Report: IG-0463 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    software, including electronic mail, word processing, spreadsheet, database management, application development, statistical analysis, presentation, security and virus protection. ...

  20. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: Energy.gov [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  1. Microsoft Word - Current Contact Information2.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information: Name: Date: Z Number: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Mailing Address: Street or PO Box Apt...

  2. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  3. Amgad Elgowainy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amgad Elgowainy Team Leader/Principal Energy Systems Analyst E-mail aelgowainy@anl.gov Projects Models and Tools

  4. Amit Mandal | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amit Mandal Amit Mandal Amit Mandal Postdoctoral Research Associate E-mail: mandala@wustl.edu Website: Washington University Postdoctoral

  5. Andrew Ells | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ells Andrew Ells Andrew Ells Undergraduate Student E-mail: andrew.ells@wustl.edu Website: Washington University

  6. Andrew Novick | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Novick Andrew Novick Andrew Novick Undergraduate Student E-mail: novick@wustl.edu Website: Washington University in St. Louis

  7. Anthony Avarca | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anthony Avarca Systems Administrator Sr. Telephone 630.252.4940 E-mail aavarca@anl.gov

  8. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail: zhien@agnes.gsfc.nasa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Study: Environmental Benefits of LEDs Greater Than CFLs Study: Environmental Benefits of LEDs Greater Than CFLs December 9, 2013 - 4:13pm Addthis A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic A three-part Energy Department-funded study indicates LEDs are more environmentally friendly than compact fluorescent and incandescent lights. | Energy Department graphic

  9. DOE HQ F 1410.8 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DOE HQ F 1410.8 Form used to notify mail recipients that they have mail to be picked up. PDF icon Notification of Incoming Mail More Documents & Publications DOE HQ F 1410.2 Headquarters Facilities Master Security Plan - Chapter 5, Classified Matter Protection and Control DOE F 1500.4

  10. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Che, Guang-Bo, E-mail: guangboche@jlnu.edu.cn (1) Chern, I-Liang, E-mail: chern@math.ntu.e... Sciences ; Chern, I-Liang, E-mail: chern@math.ntu.edu.tw ; Department of Mathematics, ...

  11. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues

  12. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Postdoctoral Program Lead Kristene (Tina) Henne Phone: 630.252.2907 E-mail: khenne@anl.gov Administrative Support Kathy Eggers Phone: 630.252.6034 E-mail: eggers@anl.gov Mailing Address Argonne National Laboratory Postdoctoral Program Office Building 201, Room 151 9700 South Cass Avenue Argonne, Illinois 60439 U.S.A.

  13. Alumni | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alumni Alumni Khem Acharya Alumnus E-mail: khem@k-state.edu Peter Adams Alumnus Christine Ajinjeru Alumna Srinivasa Rao Allu Alumnus Woo-Jin An Woo-Jin An Alumnus E-mail: woojinan@wustl.edu Stephen Anthony Alumnus David Armstrong Alumnus Khuram Ashraf Khuram Ashraf Alumnus Angela Barragan Alumnus Hannah Behar Alumna Sasha Berger Alumna E-mail: sashaberger@wustl.edu David Bina David Bina Alumnus E-mail: david.bina@seznam.cz Pratim Biswas Pratim Biswas Alumnus E-mail: pratim.biswas@wustl.edu

  14. 6/17/10 11:48 AM

    Office of Environmental Management (EM)

    8 AM mail 2552×3320 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.3&disp=inline&realattid=f_gajudmr22&zw 6/17/10 11:50 AM mail 2552×3340 pixels Page 1 of 1 https://mail.google.com/mail/?ui=2&ik=a8112e8de8&view=att&th=12946e1921eda067&attid=0.5&disp=inline&realattid=f_gajue1sa4&zw 6/17/10 11:50 AM mail 2548×3348 pixels Page 1 of 1

  15. Solar Newsletters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletters Solar Newsletters The SunShot Initiative offers e-newsletters to provide up-to-date information about our latest activities and upcoming funding opportunities. The SunShot newsletter provides weekly e-mail updates on solar office activities, events, funding opportunities, and publications. The SunShot concentrating solar power newsletter provides quarterly e-mail updates specific to the CSP industry. Update your subscriptions, modify your password or e-mail address, or stop

  16. Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contacts Contacts U.S. Department of Energy SunShot Initiative Phone: 202-287-1862 Email: solar@ee.doe.gov Mailing Address: 1000 Independence Avenue, SW Washington, DC, 20585 Additional information about visiting our offices. EPA Green Power Partnership Phone: 202-343-9859 Email: James Critchfield, GPP Program Manager critchfield.james@epa.gov Mailing address: U.S. Environmental Protection Agency 1200 Pennsylvania Ave., NW Mail Code 6202J Washington, DC 20460

  17. Health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  18. Experimental tests of paleoclassical transport

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Livermore National Laboratory, Livermore, CA 94551-0808, USA 11 Georgia Tech, Atlanta, GA 30332, USA 12 Johns Hopkins University, Baltimore, MD 21218, USA E-mail: ...

  19. Marianne Mintz | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Marianne Mintz Marianne Mintz Team Leader - Energy Systems Analysis E-mail mmintz@anl.gov Projects Economic and Infrastructure Analysis Transportation Systems and Market Assessment...

  20. Search...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Agencies can also send job announcements via mass e- mails to students with disabilities ... or no usable vision, beyond light perception) 23- Inability to read ordinary size ...

  1. Henning Lohse-Busch | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Henning Lohse-Busch Section Manager - Vehicle Systems Research E-mail hlb@anl.gov Projects Vehicle Thermal Management Vehicle and Component Benchmarking...

  2. Locations of Industrial Assessment Centers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Assessment Centers (IACs) Locations of Industrial Assessment Centers ... John Gardner Phone: (208) 426-5702 E-mail: jgardner@boisestate.edu Address: CAES Energy ...

  3. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Akai, Tomoko, E-mail: t-akai@aist.go.jp Advanced Glass Group, Research Institute for Ubiquitous Energy Devices, National Institute of Advanced Industrial Science and Technology ...

  4. CCEI REU Program Application | University of Delaware

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Street: City: State: Zip: Contact Information: Cell Phone: Email: Demographics Gender: Male Female Housing: Will you need campus housing? Yes No Citizenship:...

  5. Essam M. El-Hannouny | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Essam El-Hannouny Essam M. El-Hannouny Mechanical Engineer Telephone (630) 252-4976 E-mail essam@anl.gov

  6. Contact Us | Center for Energy Efficient Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Address: Center for Energy Efficient Materials University of California Santa Barbara, CA 93106-9560 Location: Center for Energy Efficient Materials Phelps 2300 University ...

  7. EIA-Voluntary Reporting of Greenhouse Gases Program - Contact

    U.S. Energy Information Administration (EIA) Indexed Site

    Contact Voluntary Reporting of Greenhouse Gases Program Contact For more information on the Voluntary Reporting of Greenhouse Gases Program, contact us via e-mail, phone, fax, or ...

  8. Jaclyn Murton | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jaclyn Murton Jaclyn Murton Jaclyn Murton Technologist E-mail: jkmurto@sandia.gov Website: Sandia National Laboratories Research and Technical Associates

  9. Updates - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updates by Diane Johnson Email Alerts Subscribe to automatic e-mail notification about updates to the portal. Email Alerts Document Actions...

  10. Matthew Johnson | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Johnson Matthew Johnson Matthew Johnson Assistant Professor E-mail: matt.johnson@sheffield.ac.uk Website: University of Sheffield Dr. Johnson is an Assistant Professor at the...

  11. Sam Barnett | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sam Barnett Sam Barnett Sam Barnett Graduate Student E-mail: sbarnett1@sheffield.ac.uk Website: University of Sheffield Graduate Students

  12. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Interaction in Crystals for Emission of RADiation collaboration at Mainzer Mikrotron: Design, commissioning, and tests Lietti, D., E-mail: Daniela.Lietti@cern.ch ; Backe, H. ;...

  13. Timothy Allison | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Timothy Allison Timothy Allison Energy & Environmental Policy Scientist Telephone 630-252-3209 E-mail tallison@anl.gov

  14. Occupational Radiation Exposure | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Technical Support Contacts: REMS Project or any regulationspolicy issues: Nirmala Rao | (301) 903-2297 *E-mail Contact Preferred REMS System Support: Derek Hagemeyer | (865)...

  15. Solar Energy to Help Heat Major Commercial Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    For more information contact: e:mail: Public Affairs Golden, Colo., June 21, 1996 -- An innovative solar energy technology will have its first commercial application in Colorado at ...

  16. POLICY GUIDANCE MEMORANDUM #11A Approval Process for Dual Compensation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Ahtora Brooks Human Resource Specialists E-mail Ahtora.Brooks@Hq.Doe.Gov ... Phased Retirement Manager's Desk Reference on Human Capital Management Flexibilities

  17. SUSANA MARTINEZ Governor JOHN A SANCHEZ Lieutenant Governor

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Health Division CERTIFIED MAIL- RETURN RECEIPT REQUESTED April30, 2014 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P. 0. Box 3090 Carlsbad,...

  18. Xia Huang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xia Huang Xia Huang Xia Huang Graduate Student E-mail: xhuang15@sheffield.ac.uk Website: University of Sheffield Graduate Students

  19. Xun Lu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Xun Lu Xun Lu Xun Lu Postdoctoral Research Associate E-mail: lux1@ornl.gov Website: Oak Ridge National Laboratory Postdoctoral Associates

  20. Yan (Joann) Zhou | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Joann Zhou Yan (Joann) Zhou Assistant Transportation Systems Analyst E-mail yzhou@anl.gov Projects Light Duty Electric Drive Vehicles Monthly Sales Updates The VISION Model

  1. Yaya Wang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yaya Wang Yaya Wang placeholder image Yaya Wang Research Affiliate Student E-mail: yaywang@clarku.edu Research Affiliate Associates &

  2. YoungHo Shin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    YoungHo Shin YoungHo Shin Principal Process Development Engineer Telephone (630) 252-4861 E-mail yshin@anl.gov

  3. YuPo Lin | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Yupo Lin YuPo Lin ElectroChemical and Bioprocessing Engineer E-mail yplin@anl.gov Projects Innovative Separations Resin Wafer Electrodeionization

  4. Yue Lu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Yue Lu Yue Lu Yue Lu Graduate Student E-mail: luyue@wustl.edu Website: Washington University in St. Louis Graduate

  5. Fred Loebl

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Stop 100PGF Berkeley, CA 94720 US Biographical Sketch Fred has a master's degree in Biomedical Engineering from the University of Virginia. He has been administering and...

  6. Beamline 10.0.1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    electron systems using angle-resolved photoemission of solids Experimental techniques Angle-resolved photoemission from solids Local contactspokesperson This e-mail address is...

  7. Beamline 7.0.2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cooling Experimental techniques XPS, NEXAFS, imaging of areas up to 100 m across Local contact Spokesperson This e-mail address is being protected from spambots. You need...

  8. Storage Ring Parameters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    functions of the superbends and the insertion devices. For more precise information, contact Christoph Steier ( This e-mail address is being protected from spambots. You need...

  9. NREL: Energy Analysis - Tian Tian

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E-mail: Tian.Tian@nrel.gov Areas of expertise Energy policy and market analysis International stakeholder engagement Primary research interests Renewable energy...

  10. STUDYING LARGE- AND SMALL-SCALE ENVIRONMENTS OF ULTRAVIOLET LUMINOUS

    Office of Scientific and Technical Information (OSTI)

    CA 91101 (United States); Neff, Susan G. Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States), E-mail:...

  11. "Title","Creator/Author","Publication Date","OSTI Identifier...

    Office of Scientific and Technical Information (OSTI)

    CA 91101 (United States); Neff, Susan G. Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States), E-mail:...

  12. Article 29 Employee Awards | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cash Award. PDF icon Article 29 Employee Awards Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail lorrenda.buckner@hq.doe.go...

  13. POLICY GUIDANCE MEMORANDUM #29 Employment Offers Letters Performance...

    Broader source: Energy.gov (indexed) [DOE]

    29 Employment Offers Letters Performance Management Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail lorrenda.buckner@hq.doe.go...

  14. Benoit Roux | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benoit Roux Senior Scientist (Joint Appointment) & Professor, The University of Chicago Telephone 773.834.3557 E-mail roux@uchicago.edu

  15. Brandon Fisher | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Engineering Specialist Senior Brandon Fisher News Atomically Thin Metallic Boron Telephone 630.252.5324 Fax 630.252.4646 E-mail bfisher@anl.gov

  16. Subscribe

    Broader source: Energy.gov [DOE]

    Sign up to receive brief, periodic announcements by e-mail. These updates are "quick reads" and an excellent way to stay informed. Learn about the following topics:

  17. Payment Options - Combustion Energy Frontier Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Payment Options Payment Options Payment by Check: Pay To: The Trustees of Princeton University Mail Checks To: Princeton University Attn: Lilian Tsang EQUAD D334 Olden Street...

  18. Better Buildings Residential Network Data & Evaluation Peer Exchange...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Analysis 9 Custom database tools * Forecast vs. actual-YTD and weekly * Direct mail ... * Workforce Data * Neighborhood and geographic data * Conversion rates 1 0 Forecast vs. ...

  19. Industrial Assessment Centers Identifying Energy Savings in Water...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    West Virginia University Director: Dr. B. Gopalakrishnan (304) 293-4607, 3709 Bhaskaran.Gopalakrishnan@ mail.wvu.edu DOE Headquarters Program Manager: John Smegal ...

  20. Jupiter Laser Facility Target Fab Request Requester: Date...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sketches: Jupiter Laser Facility Target Fab Request Requester: Date Requested: Phone or E-Mail: Date Required: Target Name: Reference : Laser System: Project: Task:

  1. Role of the antiferromagnetic pinning layer on spin wave properties...

    Office of Scientific and Technical Information (OSTI)

    Authors: Gubbiotti, G., E-mail: gubbiotti@fisica.unipg.it ; Tacchi, S. 1 ; Del Bianco, ... 4 ; Tamisari, M. 4 ; Dipartimento di Fisica e Geologia, Universit di Perugia, ...

  2. DOE-STD-4001-2000; Design Criteria Standard for Electronic Records...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... for documents that are received through electronic mail. (36 CFR 1234.2, reference 2.j) ... Records include all books, papers, maps, photographs, machine-readable materials, and ...

  3. Date centerdTimes New Roman

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by meeting with andor sending electronic mail messages to five prospective ... of all activity and associated fees and books for all attendees, was almost one-third ...

  4. Contact Us | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Our Teams User Advisory Council Careers Margaret Butler Fellowship Visiting Us Contact Us Contact Us Your name * Your e-mail address * Subject * Message * Verification *...

  5. Contact Us - SRSCRO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    contact Contact Us For further information concerning the SRS Community Reuse Organization, contact: Mailing Address: SRSCRO P. O. Box 696 Aiken, SC 29802 Physical Address: SRSCRO...

  6. National Security Science | Los National Alamos Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this Issue (pdf) In 2012 NSS received an NNSA Defense Programs AWARD OF EXCELLENCE National Security Science Mail Stop A142 Los Alamos National Laboratory Los Alamos, NM...

  7. Klaus Schulten | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Klaus Schulten Klaus Schulten Klaus Schulten Klaus Schulten Principal Investigator E-mail: schulten@illinois.edu Phone: 217.244.1604 Principal Investigator Dr. Schulten's research...

  8. Christine Pavia | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pavia Christine Pavia Christine Pavia Undergraduate Student E-mail: christine.pavia@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the...

  9. Gary Brudvig | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gary Brudvig Gary Brudvig Gary Brudvig Scientific Advisory Committee Member E-mail: gary.brudvig@yale.edu Website: Yale University Scientific Advisory Committee Member Dr....

  10. Mengran Liu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mengran Liu Mengran Liu placeholder image Mengran Liu Graduate Student E-mail: mliu5@ncsu.edu Website: North Carolina State University Graduate...

  11. Durgesh Rai | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Durgesh Rai Durgesh Rai Durgesh Rai Postdoctoral Research Associate E-mail: raidk@ornl.gov Website: Oak Ridge National Laboratory Postdoctoral Associates...

  12. Michal Gwizdala | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michal Gwizdala Michal Gwizdala Michal Gwizdala Postdoctoral Research Associate E-mail: m.s.gwizdala@vu.nl Website: Vrije Universiteit, Amsterdam Research Affiliate Associates &...

  13. Greg Scholes | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Scholes Greg Scholes Greg Scholes Principal Investigator E-mail: gscholes@princeton.edu Phone: (609) 258-0729 Website: Princeton University Principal Investigator (2014 -...

  14. Ingrid Archibald | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ingrid Archibald Ingrid Archibald Ingrid Archibald Undergraduate Student E-mail: ingridarchibald@wustl.edu Website: Washington University in St. Louis Undergraduate student...

  15. Amanda Brindley | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amanda Brindley Amanda Brindley Amanda Brindley Laboratory Technician E-mail: a.brindley@sheffield.ac.uk Website: University of Sheffield Research and Technical Associates...

  16. Channing Hunter | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Channing Hunter Channing Hunter Channing Hunter Undergraduate Student E-mail: channing.hunter@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled...

  17. Heiko Lokstein | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Heiko Lokstein Heiko Lokstein Heiko Lokstein Research Associate E-mail: heiko.lokstein@glasgow.ac.uk Website: University of Glasgow Research and Technical Associates...

  18. Nesia Zurek | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nesia Zurek Nesia Zurek Nesia Zurek Postdoctoral Associate E-mail: nesia505@gmail.com Website: University of New Mexico Postdoctoral Associates...

  19. Elizabeth Martin | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Elizabeth Martin Elizabeth Martin placeholder image Elizabeth Martin Laboratory Technician E-mail: e.martin@sheffield.ac.uk Website: University of Sheffield Research and Technical...

  20. Sasha Berger | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sasha Berger Sasha Berger Sasha Berger Undergraduate Student E-mail: sashaberger@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the PARC...

  1. Jack Chidgey | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jack Chidgey Jack Chidgey Jack Chidgey Graduate Student E-mail: j.chidgey@sheffield.ac.uk Website: University of Sheffield Graduate Students...

  2. Megan Kerstein | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Megan Kerstein Megan Kerstein Megan Kerstein Undergraduate Student E-mail: mkkerstein@wustl.edu Website: Washington University in St. Louis Undergraduate student enrolled in the...

  3. Chris Sherman | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chris Sherman Chris Sherman Chris Sherman Chris Sherman ResearchLab Assistant E-mail: shermanc@wustl.edu Research and Technical Associates...

  4. Caroline Focht | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Caroline Focht Caroline Focht Caroline Focht Undergraduate Student E-mail: caroline.focht@wustl.edu Website: Washington University Undergraduate student enrolled in the PARC...

  5. Michael Gross | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Michael Gross Michael Gross Michael Gross Principal Investigator E-mail: mgross@wustl.edu Phone: (314) 935-4814 Website: Washington University in St. Louis Principal Investigator...

  6. Margherita Maiuri | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Margherita Maiuri Margherita Maiuri Margherita Maiuri Postdoctoral Research Associate E-mail: mmaiuri@princeton.edu Website: Princeton University Postdoctoral Associates...

  7. Liron David | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liron David Liron David placeholder image Liron David Alumnus E-mail: liron.david@childrens.harvard.edu Website: Harvard University Formerly a student of PARC Research Affiliate...

  8. Maitrayee Bhattacharyya | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Maitrayee Bhattacharyya Maitrayee Bhattacharyya Maitrayee Bhattacharyya Senior Research Associate E-mail: maitrayee@biology2.wustl.edu Website: Washington University in St. Louis...

  9. Don Hood | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Don Hood Don Hood Don Hood Graduate Student E-mail: dhood@wustl.edu Website: Washington University in St. Louis Graduate Students...

  10. Kyle Cepeda | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kyle Cepeda Kyle Cepeda Kyle Cepeda Undergraduate Student E-mail: kcepeda@wustl.edu Website: Washington University Undergraduate student enrolled in the PARCI-CARES Certificate of...

  11. Carrie Goodson | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carrie Goodson Carrie Goodson Carrie Goodson Research Technician E-mail: cgoodson@wustl.edu Website: Washington University Research and Technical Associates...

  12. David Swainsbury | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Swainsbury David Swainsbury David Swainsbury Postdoctoral Research Associate E-mail: d.swainsbury@sheffield.ac.uk Website: University of Sheffield Postdoctoral Associates...

  13. U.S. Department of Energy Interim E-QIP Procedures | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Energy Security Symposium OE Releases Second Issue of Energy Emergency Preparedness Quarterly (April 2012) V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets...

  14. Working Remotely | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    instant messages with Jabber Access your voice mail Collaboration Host a meeting with Blue Jeans Access your files on Box Argonne SharePoint Server (login required) Cyber...

  15. NREL: Energy Analysis - Kathleen Nawaz

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E-mail: kathleen.nawaz@nrel.gov Areas of expertise Global climate change and renewable energy Co-benefitsdevelopment impact analysis Low carbon transportation Primary research...

  16. Los Alamos National Laboratory Postdoctoral Career Fair 2015

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Form August 25 - 27, 2015 Company Name Mailing Address City State Zip Code Contact Person: Name Telephone email Recruiter 1 Name Recruiter 2 Name Recruiter 3 Name Recruiter...

  17. Research Affiliate Associates & Students | Photosynthetic Antenna...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Affiliate Associates & Students Research Affiliate Associates & Students Michal Gwizdala Postdoctoral Research Associate E-mail: m.s.gwizdala@vu.nl Atsuko Kanazawa Research...

  18. George Waldmann | Department of Energy

    Energy Savers [EERE]

    George Waldmann George Waldmann Phone 202-586-9904 E-mail george.waldmann@hq.doe.gov Last Name Waldmann First Name George

  19. Ina Shaw | Department of Energy

    Energy Savers [EERE]

    Ina Shaw Ina Shaw Phone 202-586-8464 E-mail ina.shaw@hq.doe.gov Last Name Shaw First Name Ina Title HUMAN

  20. Jennifer Ackerman | Department of Energy

    Energy Savers [EERE]

    Ackerman Jennifer Ackerman Phone (202) 586-3860; E-mail jennifer.ackerman@hq.doe.gov Last Name Ackerman First Name Jennifer Title Director, Human Capital Policy

  1. Thomasina Mathews | Department of Energy

    Energy Savers [EERE]

    Thomasina Mathews Thomasina Mathews Phone 202-586-2657 E-mail thomasina.mathews@hq.doe.gov Last Name Mathews First Name Thomasina Title PROGRAM MANAGER

  2. Renewable energy generation sources...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Renewable Systems & Energy Infrastructure | Solar Programs For more information please contact: William Kolb E-mail: wjkolb@sandia.gov Phone (505) 844-1935 Website: ...

  3. NREL Offers Renewable Energy Award at International Competition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Offers Renewable Energy Award at International Competition For more information contact: e:mail: Public Affairs Golden, Colo., May 13, 1998 The National Renewable Energy ...

  4. Jeongwoo Han | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jeongwoo Han Jeongwoo Han Assistant Energy Systems Analyst E-mail jhan@anl.gov Projects Novel Processing of Waste Streams for Fuels and Co-products

  5. Jonathan Kessler | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jonathan Kessler Jonathan Kessler Jonathan Kessler Research Affiliate Student E-mail: j.kessler@wustl.edu Website: Washington University in St. Louis Research Affiliate Associates & Students

  6. Jonathan Logan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Ian McNulty) Jonathan Logan Telephone 630.252.4874 Fax 630.252.5739 E-mail jmlogan

  7. Kirsty Hacking | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Kirsty Hacking Kirsty Hacking Kirsty Hacking Graduate Student E-mail: k.hacking.1@research.gla.ac.uk Website: University of Glasgow Graduate

  8. Spin Seebeck devices using local on-chip heating (Journal Article...

    Office of Scientific and Technical Information (OSTI)

    measurements. Authors: Wu, Stephen M., E-mail: swu@anl.gov ; Fradin, Frank Y. ; Hoffman, Jason ; Hoffmann, Axel ; Bhattacharya, Anand 1 + Show Author Affiliations...

  9. Customized atomic force microscopy probe by focused-ion-beam...

    Office of Scientific and Technical Information (OSTI)

    Authors: Wang, Andrew ; Butte, Manish J., E-mail: manish.butte@stanford.edu 1 + Show Author Affiliations Department of Pediatrics, Division of Immunology, Allergy and ...

  10. The bgclang Compiler | Argonne Leadership Computing Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wrappers Mailing list and support General usage OpenMP Fast-math optimizations Vector (QPX) intrinsics and math functions Autovectorization Dynamic linking Memory bounds ...

  11. Disabled Veterans Affirmative Action Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Guide for the Disabled Veterans' Affirmative Action Program (DVAAP) PDF icon FY16 DVAAP Plan.pdf Responsible Contacts Donna Friend HUMAN RESOURCES SPECIALIST E-mail ...

  12. Antoinette Moultrie | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Antoinette Moultrie Antoinette Moultrie Phone 202-586-9662 E-mail antoinette.moultrie@hq.doe.gov Last Name Moultrie First Name Antoinette Title HUMAN RESOURCES SPECIALIST

  13. Donna Friend | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Donna Friend Donna Friend Phone 202-586-5880 E-mail donna.friend@hq.doe.dov Last Name Friend First Name Donna Title HUMAN RESOURCES SPECIALIST

  14. Lynn Proctor | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Lynn Proctor Lynn Proctor Phone 202-586-9545 E-mail lynn.proctor@hq.doe.gov Last Name Proctor First Name Lynn Title HUMAN RESOURCES SPECIALIST

  15. Keidra Biddiex | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Keidra Biddiex Keidra Biddiex Phone (202) 586-7693 E-mail Keidra.Biddiex@hq.doe.gov Last Name Biddiex First Name Keidra Title Human Resources Specialist

  16. Savannah Fuqua | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Savannah Fuqua Savannah Fuqua Savannah Fuqua E-mail: savannah.fuqua@wustl.edu Website: Washington University Undergraduate student enrolled in the PARCI-CARES Certificate of ...

  17. Catharina Milostan | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policy Scientist Telephone 630-252-6009 E-mail cmilostan@anl.gov Projects Acoustic Building Infiltration Measurement SystemSonic Leak Quantifier Commercial Upstream...

  18. INS-L-10-03

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    After a thorough review of the facts, including a review of e-mails, conducting a significant number of personal interviews, administering signedsworn statements, and making ...

  19. Ming-Yang Ho | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ming-Yang Ho Ming-Yang Ho Ming-Yang Ho Graduate Student E-mail: mxh504@psu.edu Website: Pennsylvania State University Graduate Students...

  20. Eunkyung Yang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Eunkyung Yang Eunkyung Yang Eunkyung Yang Postdoctoral Research Associate E-mail: ekyang@wustl.edu Phone: 314.935.6530 Postdoctoral...

  1. Nepheline crystallization in boron-rich alumino-silicate glasses...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the range of compositions allowable for formulation while still avoiding nepheline Journal of Non-Crystalline Solids 409 (2015) 149-165 Corresponding author. E-mail...

  2. Electric field effects in graphene/LaAlO{sub 3}/SrTiO{sub 3}...

    Office of Scientific and Technical Information (OSTI)

    ; Levy, Jeremy, E-mail: jlevy@pitt.edu 1 ; Lee, Hyungwoo ; Ryu, Sangwoo ; Eom, Chang-Beom 2 ; Ghahari, Fereshte ; Ravichandran, Jayakanth ; Kim, Philip 3 + Show Author ...

  3. Mechanistic study of atomic layer deposition of Al{sub x}Si{sub...

    Office of Scientific and Technical Information (OSTI)

    Authors: Cho, Jea ; Kim, Taeseung ; Seegmiller, Trevor ; Chang, Jane P., E-mail: jpchang@ucla.edu 1 + Show Author Affiliations Department of Chemical and Biomolecular ...

  4. HIGHLY VARIABLE OBJECTS IN THE PALOMAR-QUEST SURVEY: A BLAZAR...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne ; Baltay, Charles ; Coppi, Paolo ; Ellman, Nancy ; Glikman, Eilat ; ... Ashish ; Williams, Roy, E-mail: anne.bauer@usm.uni-muenchen.d 2 + Show Author ...

  5. THE MASS-RICHNESS RELATION OF MaxBCG CLUSTERS FROM QUASAR LENSING...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne H. 1 ; Baltay, Charles ; Ellman, Nancy ; Jerke, Jonathan ; Rabinowitz, David ; Scalzo, Richard, E-mail: bauer@ieec.uab.es 2 + Show Author Affiliations ...

  6. MEASURING LENSING MAGNIFICATION OF QUASARS BY LARGE SCALE STRUCTURE...

    Office of Scientific and Technical Information (OSTI)

    Authors: Bauer, Anne H. 1 ; Seitz, Stella 2 ; Jerke, Jonathan ; Scalzo, Richard ; Rabinowitz, David ; Ellman, Nancy ; Baltay, Charles, E-mail: bauer@ieec.uab.es 3 + Show ...

  7. POLICY GUIDANCE MEMORANDUM #09A Direct Hire Authority for Acquisition...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Loretta Collier Director, Human Capital Policy Division E-mail loretta.robinson@hq.doe.gov Phone 202-586-9239 More Documents & Publications POLICY GUIDANCE ...

  8. Rui Liu | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rui Liu Rui Liu Rui Liu Graduate Student E-mail: rliu8@ncsu.edu Website: North Carolina State University Graduate

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Lin, Steven H., E-mail: shlin@mdanderson.org (2) Lopez Guerra, Jose Luis Department of ... and Oligometastasis at Diagnosis Lopez Guerra, Jose Luis ; Department of Radiation ...

  10. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Akio, E-mail: watanabea@jfrl.or.jp ; Food and Biodynamic Chemistry Laboratory, ... ; Division of Quantum Science and Engineering, Graduate School of Engineering, ...

  11. Nancy Dietz-Rago | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Materials Scientist Nancy Dietz-Rago Telephone 630.252.9798 Fax 630.252.5739 E-mail dietz@anl.gov

  12. Solar Power Ramp Events Detection Using an Optimized Swinging...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Boston, Massachusetts, USA DETC2015-46849 SOLAR POWER RAMP EVENTS DETECTION USING AN ... yzsun@mail.tsinghua.edu.cn ABSTRACT Solar power ramp events (SPREs) significantly ...

  13. Proposed Rules Federal Register

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... including those received by mail, will be posted without change to http: www.regulations.gov, including any personal information provided, and can be accessed by the public. ...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... F. ; Instituto de Fsica, Universidade de Braslia, 70910-900 Braslia ; Cappelletti, David, E-mail: david.cappelletti@unipg.it ; Pirani, Fernando Molecular beam scattering ...

  15. Citizen Potawatomi Nation

    Office of Environmental Management (EM)

    ... ID cards * Tribal Scholarships * Burial Insurance Program Mail-Order Pharmacy * Plan A - ... wind-generation, propane and natural gas distribution systems, and the future of ...

  16. OMB No. XXXX-XXX Expiration Date: XX/XX/XXXX

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BARGE, AND RAIL MOVEMENTS ACTIVITY SUMMARY For the PC Electronic Data Reporting Option (PEDRO) software, call (202) 586-9659. (See Form instructions, pg 1) Mailing Address of...

  17. EIA-814

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PART 3. IMPORTS ACTIVITY SUMMARY For the PC Electronic Data Reporting Option (PEDRO) software, call (202) 586-9659. (See Form instructions, pg 1) Mailing Address of...

  18. EIA-809_20150504.xls

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Code PART 3. OXYGENATE ACTIVITY (Barrels) For the PC Electronic Data Reporting Option (PEDRO) software, call (202) 586-9659. (See Form instructions, pg 1.) Mailing Address of...

  19. TWINS: THE TWO SHORTEST PERIOD NON-INTERACTING DOUBLE DEGENERATE...

    Office of Scientific and Technical Information (OSTI)

    Authors: Mullally, F. ; Badenes, Carles ; Lupton, Robert 1 ; Thompson, Susan E., E-mail: fergal@astro.princeton.ed 2 + Show Author Affiliations Department of Astrophysical ...

  20. Tal Heilpern | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Stephen Gray) Tal Heilpern Telephone 630.252.5884 Fax 630.252.4646 E-mail theilpern

  1. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Certified Mail March 16,2010 Ms. Susan Thauer Christie Pabarue Mortensen and Young 1880 John F. Kennedy Boulevard io" Floor Philadelphia, Pennsylvania 19103 Dear Ms. Thauer:...

  2. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Address: country Phone Number: Fax Number: E-mail: 20111110100931 Evan J. Kaufman Robbins Geller Rudman &38; Dowd LLP 58 South Service Road, Suite 200 Melville, NY 11747...

  3. Calibration of an advanced neutral...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2012. b) Author to whom correspondence should be addressed. Electronic mail: jareusch@wisc.edu. II. HARDWARE Designed at the Budker Institute of Nuclear Physics (BINP) in Russia,...

  4. Bechtel National, Inc. Engineers Constructors Oak Ridge Office

    Office of Legacy Management (LM)

    389 Bechtel National, Inc. Engineers - Constructors Oak Ridge Office Jackson Plaza Tower 800 Oak Ridge Turnpike Oak Ridge, Tennessee Mail Address: P. O. Box 350, Oak Ridge. TN...

  5. Illinois Home Performance: DOE REES-- Driving Demand: Successful Marketing Strategies

    Broader source: Energy.gov [DOE]

    Presents Illinois Home Performance's successful marketing strategies, from more than 100,000 direct mailings to multi-pronged online outreach, July 2012.

  6. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    (1) dielectric materials (1) doped materials (1) electric potential (1) electrochemistry (1) electron mobility (1) Filter by Author Feng, Ping, E-mail: pfeng@nju.edu.cn ...

  7. Extreme Environments (EFree) Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Extreme Environments (EFree ) Center LLNL Co-PI: Jonathon Crowhurst e-mail bio Novel materials for energy applications Ultrafast reflectivity measurements under high pressure...

  8. Staff Directory | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Organization Chart Staff Directory Career Opportunities Staff Directory Name Title E-mail Aithal, Shashikant Computational Science aithal@anl.gov Aydelott, Ryan M. Experimental ...

  9. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Our state-of-the-art annular bright-field imaging in aberration-corrected scanning ... A new quasidilaton theory of massive gravity Mukohyama, Shinji, E-mail: ...

  10. BPA-2011-01001-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    record, telephone messages, voice-mails or other sound recordings, notes of personal conferences, telephone conversations or personal meetings. It also includes...

  11. Elimination of a spiral wave pinned at an obstacle by a train...

    Office of Scientific and Technical Information (OSTI)

    Authors: Tanaka, Masanobu 1 ; Hrning, Marcel 2 ; Kitahata, Hiroyuki, E-mail: kitahata@chiba-u.jp 3 ; Yoshikawa, Kenichi 4 + Show Author Affiliations Department of ...

  12. ALSNews Vol. 320

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    conduct both electrons and oxygen ions), potentially valuable for high-temperature electrolysis and synthetic fuel production. Read more... Contact: This e-mail address is being...

  13. Manufacturing Consumption of Energy 1994

    U.S. Energy Information Administration (EIA) Indexed Site

    the CM, the ASM contains two components. The first component is the mail portion, a probability sample of manufacturing establishments selected from the list of establishments...

  14. HAN F OR

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fax Number: E-mail: United States na na Reasonably Describe Records: Description: Industrial Hygiene Chemical Vapor Technical Basis RPP-22491 Revision 1 Optional...

  15. Microsoft Word - FOI 2013-00962.Partial Response Item 1.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI...

  16. Geochemical Behaviour of S, Cl and Fe in Silicate Melts/Glasses...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E. Paris, P. Glatzel, S. Eeckhout, M. Carroll, School of Science and Technology, Geology Division, University of Camerino, Via G. III da Varano, 62032 Camerino; e-mail:...

  17. U.S. DEPARTMENT OF ENERGY HEADQUARTERS RECORDS HOLDING AREA

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDIVIDUAL REQUESTING OFFICE MAIL STATION RECORDS CENTER JOB NO. HIGHEST CLASSIFICATION FORWARDED (Date) RETURNED (Date) DESCRIPTION OF RECORDS LOCATION RECEIPT I have...

  18. BPA-2015-00051-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Carrie Henderson Email Organiz ation Mailing Address City State Phone FAX Ex. xxx-xxx-xxxx Date Redd: 1082014 Due Date: 1162014 Tracking Number;...

  19. Bioenergy Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advanced Search Browse by Topic Mail Requests Help Key Publications Newsletter Biomass Basics Multimedia Webinars Databases Analytical Tools Glossary Student & Educator Resources...

  20. Wind Program: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Resources Publications Advanced Search Browse by Topic Mail Requests Help Energy Basics Wind Energy FAQs Small Wind Systems FAQs Multimedia Related Links Feature featured...

  1. Department

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 25,2010 CERTIFIED MAIL Mr. Don Dickson Government Training, Inc. 5372 Sandhamn Place Longboat Key, Florida 34228 Dear Mr. Dickson: FREEDOM OF INFORMATION ACT REQUEST (FOI...

  2. TITLE

    Office of Legacy Management (LM)

    Plates are not available in electronic format. Please e-mail lm.records@lm.doe.gov to request the appendix.

  3. TITLE

    Office of Legacy Management (LM)

    Plates are not available in electronic format. Please e-mail lm.records@lm.doe.gov to request the appendix

  4. Microsoft Word - DM_DOCS-#8732-v1-July_15_Comments_on_Regional...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Northwest Renewables Utility invites you to be a Conservation Sensation 2320 California Street * Everett, WA * 98201 Mailing Address: P.O. Box 1107 * Everett, WA * 98206-1107...

  5. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Peter, E-mail: PJFischer@lbl.gov ; Physics Department, University of California, Santa Cruz, California 94056 The spectroscopic analysis of X-ray magnetic circular dichroism ...

  6. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... E-mail: d.makarov@ifw-dresden.de ; Fischer, Peter ; Physics Department, UC Santa Cruz, Santa Cruz, California 95064 ; Schmidt, Oliver G. ; Material Systems for ...

  7. A thermodynamic and kinetic model for paste-aggregate interactions...

    Office of Scientific and Technical Information (OSTI)

    Finally, these gradients have interesting implications beyond the development of ASR, creating unique biogeochemical environments. Authors: Guthrie, George D., E-mail: geo@lanl.gov ...

  8. Minnesota Power - Residential Energy Efficiency Rebate Program...

    Broader source: Energy.gov (indexed) [DOE]

    ind... State Minnesota Program Type Rebate Program Rebate Amount Refrigerator Recycling: 35-50 Refrigerator: 25 Clothes Washer: 40 mail-in rebate General Lighting:...

  9. Microsoft Word - FOI 2013-01144.Final.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    19, 2013 CERTIFIED MAIL Ms. Susannah Frame KING Television 333 Dexter Avenue North Seattle, Washington 98105 Dear Ms. Frame: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-01144)...

  10. NERSC Users Group (NUG)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group Monthly NUG Webinars Annual Meetings NUGEX Elections Charter User Announcements Help Staff Blogs Request Repository Mailing List...

  11. About EIA - Organization - U.S. Energy Information Administration...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    John Conti is the Assistant Administrator for Energy Analysis and analyzes energy supply, demand, and prices including the impact of financial markets... Read more > E-mail: ...

  12. Reddy Muthyala Nagarjuna | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reddy Muthyala Nagarjuna Reddy Muthyala Nagarjuna Reddy Muthyala Nagarjuna Postdoctoral Research Associate E-mail: nmuthya@ncsu.edu Website: North Carolina State University

  13. Microsoft Word - CAMDGasCylinderRequest.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send all signed completed scanned requests directly to davidkleinpeter@lsu.edu First Name Last Name E-mail: Telephone: Supervisor (if applicable) Department Institution:...

  14. https://www.fossil.energy.gov/app/fergas/ApplicationAction.go

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Code: Phone Number: ext. Fax: E-mail: Report Contact (Monthly Reports) Information: First Name: Last Name: Middle Initial: PositionTitle: Country: Street: City: StateProvince:...

  15. Enhancing Railroad Hazardous Materials Transportation Safety

    Office of Environmental Management (EM)

    * Two Options * Two Options * Fusion Centers * Direct Hazmat * Carriers must provide name, title, telephone number, and e-mail address to fusion centers and those address to...

  16. Marcy Rood | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Marcy Rood Principal Environmental Analyst - Clean Cities E-mail mroodwerpy@anl.gov Projects Clean Cities Clean Cities University Workforce Development Program

  17. Matthew E. Riddle | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Matthew Riddle Matthew E. Riddle Assistant Energy Scientist E-mail meriddle@anl.gov Projects Uncertainty Analysis and Bayesian Calibration

  18. TITLE AUTHORS SUBJECT SUBJECT RELATED DESCRIPTION PUBLISHER AVAILABILI...

    Office of Scientific and Technical Information (OSTI)

    Cass Avenue HEP Argonne IL United States E mail zachos anl gov CLASSICAL AND QUANTUM MECHANICS GENERAL PHYSICS COMPACTIFICATION DUALITY FERMIONS GAUGE INVARIANCE HOLOGRAPHY MANY...

  19. Christopher T. [Fermi National Accelerator Laboratory, P.O. Box...

    Office of Scientific and Technical Information (OSTI)

    IL 60439-4815 (United States), E-mail: zachos@anl.gov 71 CLASSICAL AND QUANTUM MECHANICS, GENERAL PHYSICS; COMPACTIFICATION; DUALITY; FERMIONS; GAUGE INVARIANCE; HOLOGRAPHY;...

  20. ARM - Field Campaign - Fall 1997 Shortwave IOP

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pacific Northwest national Laboratory Office phone: (509) 372-6049 E-mail: dwslater@pnl.gov Data Single Point of Contact: Participants: Principle Investigator: - Robert...

  1. Daniel Molzahn | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Daniel Molzahn Daniel Molzahn Computational Engineer, Energy Systems Modeling & Simulation News Research projects will help optimize grid E-mail dmolzahn

  2. Respond to the article | Department of Energy

    Office of Environmental Management (EM)

    the article Tips: Home Office and Electronics. Your response * Your email (optional) Send message Contact Us E-mail: Webmaster Online: Facebook iconconnecttwitter.png Twitter...

  3. Laurie Eichberger | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executive Secretary Laurie Eichberger Telephone 630.252.7570 Fax 630.252.6866 E-mail eichberger@anl.gov

  4. Lifen Wang | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lifen Wang Postdoctoral Appointee (Supervisor, Dean Miller) Telephone (630) 557-9185 E-mail lifenwang@anl.gov CV/Resume File Wang, Lifen - Bio.docx

  5. BCDA - Beamline Controls and Data Acquisition Group

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * Data Acquisition * ebrick * Hardware * Software * Group Info * Sector Contacts * Knowledge Base * Meetings * Mailing list * APS PV Information * EPICS Naming Convention Print...

  6. ALSNews Vol. 326

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    below which electrons, instead of pairing up, organize themselves in a drastically different, yet still elusive, way. Read more... Contact: This e-mail address is being...

  7. Shrirang Abhyankar | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Photo of Shrirang Abhyankar Shrirang Abhyankar Computational Engineer Telephone (630) 252-0219 E-mail abhyshr@anl.gov Projects Distribution Automation

  8. Meghan Barnhart-Dailey | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meghan Barnhart-Dailey Meghan Barnhart-Dailey Meghan Barnhart-Dailey Postdoctoral Research Associate E-mail: mbarnha@sandia.gov Website: Sandia National Laboratories Postdoctoral

  9. Spin waves in micro-structured yttrium iron garnet nanometer...

    Office of Scientific and Technical Information (OSTI)

    B., E-mail: jungfleisch@anl.gov ; Zhang, Wei ; Jiang, Wanjun ; Wu, Stephen M. ; Pearson, John E. ; Bhattacharya, Anand ; Hoffmann, Axel 1 ; Chang, Houchen ; Wu, Mingzhong...

  10. Project Chariot - Final Report, Archaeological Survey and Excavations at Ogotoruk Creek, Northwestern Alaska, December 1961

    Office of Legacy Management (LM)

    Only critical information was scanned. Entire document is available upon request Please e-mail lm.records@lm.doe.gov to

  11. Aculeatin, a coumarin derived from Toddalia asiatica (L.) Lam...

    Office of Scientific and Technical Information (OSTI)

    has been utilized traditionally for medicinal purposes such as the treatment of diabetes. ... of lipid abnormalities as well as diabetes. less Authors: Watanabe, Akio, E-mail: ...

  12. Ion beam requirements for fast ignition of inertial fusion targets...

    Office of Scientific and Technical Information (OSTI)

    Authors: Honrubia, J. J., E-mail: javier.honrubia@upm.es 1 ; Murakami, M. 2 + Show Author Affiliations ETSI Aeronuticos, Universidad Politcnica de Madrid, Madrid (Spain) ...

  13. POLICY GUIDANCE MEMORANDUM #07 Current Appropriations Law and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Foreign Nationals Responsible Contacts Jennifer Ackerman Director, Human Capital Policy E-mail jennifer.ackerman@hq.doe.gov Phone (202) 586-3860; More Documents & ...

  14. POLICY GUIDANCE MEMORANDUM #02 Using Schedule A Hiring Authority...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRA Positions (Expired) Responsible Contacts Jennifer Ackerman Director, Human Capital Policy E-mail jennifer.ackerman@hq.doe.gov Phone (202) 586-3860; More Documents & ...

  15. POLICY GUIDANCE MEMORANDUM #35 Procedures for Compliance with...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Responsible Contacts Jennifer Ackerman Director, Human Capital Policy E-mail jennifer.ackerman@hq.doe.gov Phone (202) 586-3860; More Documents & Publications Inspection Report: ...

  16. MHK Technologies/WaveTork | Open Energy Information

    Open Energy Info (EERE)

    E mail for more information Technology Dimensions Device Testing Date Submitted 27:56.2 << Return to the MHK database homepage Retrieved from "http:en.openei.orgw...

  17. BPA-2013-01651-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    destroy written or ele ctronic documents (including e- mails) related to BPA's veterans hiring practices or allegations of bias or allegations of retaliation. 2. The distribution...

  18. Dean Carbaugh | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Senior Technician Dean Carbaugh Telephone 630.252.4833 Fax 630.252.5739 E-mail dcarbaugh@anl.gov

  19. Deborah O'Rourke | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Deborah O'Rourke NST Assistant Division Director Telephone 630.252.3810 Fax 630.252.6866 E-mail dorourke

  20. Monthly PDSF User Meeting Minutes

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status...

  1. Accounts & Allocations

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status...

  2. Computational Systems

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status...

  3. Letter Temple

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 06/04/15 Note: Form must be filled out completely and signed prior to submittal to the following address: Nuclear Waste Partnership LLC PO Box 2078 GSA-207 Carlsbad, NM 88221 FAX: (575) 234-7050 Company Name: Address: Phone: City: State: Zip(+4): e-Mail: REMITTANCE ADDRESS (if different) Address: City: State: Zip(+4): e-Mail: Other: Address: City: State: Zip(+4): Country Code: COMPANY CONTACTS Manager Name: Sales Name: Phone: Cell: Phone: Cell: e-Mail e-Mail Service Name: Accounts Payable

  4. Pu Qian | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Pu Qian Pu Qian placeholder image Pu Qian Postdoctoral Associate E-mail: p.qian@sheffield.ac.uk Postdoctoral Associates

  5. BPA-2012-01879-FOIA Response

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OR 97208 (503) 230-5293 kireuven(bpa. gov Contract No. 48196, Modification 2 Page 2 UNITED STATES CONTRACT BONNEVILLE GOVERNMENT QWER ADMIIUSTRATION Mail Invoice To: .See...

  6. Staff

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    worked as an editorial assistant for Nevada Magazine. Ms. Snyder earned a Bachelor of Arts in Corporate Communication from the University of Nevada, Las Vegas. Send mail to...

  7. outstandingcheckform_new

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated: 042010 Chief Financial Officer Division Treasury Cashiers Office Treasury, Pension, & Tax CFO-TPT, Mail Stop P231 Los Alamos National Laboratory Los Alamos, NM 87544...

  8. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... National Laboratory, Oak Ridge, Tennessee 37831 ; Shi, Hongliang ; Siegrist, Theo ; Singh, David J., E-mail: singhdj@missouri.edu The electronic and optical properties of bulk ...

  9. Development of a prototype Open-close positron emission tomography...

    Office of Scientific and Technical Information (OSTI)

    Authors: Yamamoto, Seiichi, E-mail: s-yama@met.nagoya-u.ac.jp ; Okumura, Satoshi ; Komori, Masataka ; Ogata, Yoshimune ; Kato, Katsuhiko 1 ; Watabe, Tadashi ; Ikeda, Hayato ; ...

  10. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Search for: All records CreatorsAuthors contains: "Terwilliger, Thomas C" Sort by ... Filter by Author Terwilliger, Thomas C. (37) Terwilliger, Thomas C., E-mail: ...

  11. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    (1) nanoscience and nanotechnology (1) photodetectors (1) rubidium compounds (1) silver compounds (1) wavelengths (1) Filter by Author Sun, Jia-Lin, E-mail: ...

  12. BPA-2013-01459-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Charles Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street Suite 1050 City Portland...

  13. BPA-2015-01295-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    this form. Name Chuck Johnson Email chuckoregonpsr.org Organization Oregon Physicians for Social Responsibility Mailing 812 SW Washington Street, Suite 1050 Address Date Rec'd: 5...

  14. BPA-2013-01457-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Charles Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street Suite 1050 City Portland...

  15. BPA-2015-00158-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Number: BPA-201 5-00 1 58-F Email chuckoregonpsr.org Organization Oregon Physicians for Social Responsibility Mailing 812 SW Washington Street, Suite 1050 Address Reasonably...

  16. BPA-2015-01211-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Number: BPA-2015-0121 1-F Email chuckoregonpsr.org Organization Oregon Physicians for Social Responsibility Mailing 812 SW Washington Street, Suite 1050 Address City Portland...

  17. BPA-2013-01495-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on this form. Name Chuck Johnson Email chuck@oregonpsr.org Organization Physicians for Social Responsibility Mailing Address 812 SW Washington Street, Suite 1050 City Portland...

  18. Joonseok Lee | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fellow (Supervisor, Elena Roshkova) News Piezoelectrically enhanced ferroelectric polymers via nanoscale mechanical annealing Telephone 630.252.7317 Fax 630.252.4646 E-mail...

  19. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... Band structure of topological insulators from noise measurements in tunnel junctions Cascales, Juan Pedro, E-mail: juanpedro.cascales@uam.es ; Martnez, Isidoro ; Aliev, Farkhad ...

  20. Beamline 9.3.1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    environment 10-7 Torr Experimental techniques XAS, XAFS, NEXAFS Sample handling automation Yes, rotation and Z Spokesperson This e-mail address is being protected from...

  1. EM SSAB Local Board Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EM SSAB Local Board Contacts EM SSAB Local Board Contacts EM SSAB Federal Coordinators Hanford Kristen Skopeck Phone: (509) 376-5803 Fax: (509) 376-1563 E-mail: kristen.skopeck@rl.doe.gov Oak Ridge Melyssa Noe Phone: (865) 241-3315 Fax: (865) 241-6932 E-mail: noemp@oro.doe.gov Idaho Robert Pence Phone: (208) 526-6518 Fax: (208) 526-8789 E-mail: pencerl@id.doe.gov Paducah Robert Smith Phone: (270) 441-6821 Fax: (270) 441-6801 E-mail: robert.smith@lex.doe.gov Nevada Kelly Snyder Phone: (702)

  2. How Do I Get Authorization to Work with Lasers at the ALS?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    controls (beam containment, interlocks) and administrative controls (training, signage). Through This e-mail address is being protected from spambots. You need JavaScript...

  3. OCPR Forms | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OCPR Forms Technology Transfer Reporting Form Mediation Survey Form Agreement to Mediate Form Instructions: Fill out the form and e-mail the completed document to Office of ...

  4. Monthly Energy Review - March 2001

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and additional mailing offices. POSTMASTER: Send address changes to Monthly Energy Review, Energy Information Administration, EI-30, 1000 Independence Avenue, SW,...

  5. Fuel Cell Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Technologies Office EERE Fuel Cell Technologies Office Share this resource Publications Advanced Search Browse by Topic Mail Requests Help Feature featured product...

  6. Forrest Jehlik | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Forrest Jehlik Principal Mechanical Engineer - Vehicle Systems Research, Green Racing Program E-mail fjehlik@anl.gov Projects Green Racing

  7. Glenn Keller | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Glenn Keller Principal Project Engineering Specialist News Technologist in Residence pilot program pairs companies with national labs to advance clean energy E-mail gkeller@anl.gov

  8. Greg Krumdick | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greg Krumdick Principal Systems Engineer Telephone (630) 252-3952 E-mail gkrumdick@anl.gov Projects Process Development and Scale-up Program

  9. Gregory Orf | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Gregory Orf Gregory Orf Gregory Orf Gregory Orf Graduate Student E-mail: gregory.s.orf@go.wustl.edu Phone: (314) 935-6530

  10. Sandia National Laboratories: Awards & Other News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... It ignores common interferents and analyzes chemical warfare agents in 20 seconds. The ... Program Contact Us MSTC Business Information E-mail: MSTC View All Jobs Search for ...

  11. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Identification Device User print name Government AgencySponsored Company Visitor's Z Number or ID Number Email Address Phone Number Fax Number Mail Stop and Office Location...

  12. Microsoft Word - fellows_nomination_reworked.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name:...

  13. Fermilab Today - Troubleshooting

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Today Fermilab Today is distributed via e-mail each morning by the same program. Internet service providers are aggressively filtering spam due to the proliferation of spam...

  14. 2012 User Meeting Workshops

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Workshops Print 2012 ALS User Meeting Workshops Home Agenda Awards Exhibitors Lodging Posters Registration Transportation Workshops This e-mail address is being protected from...

  15. 2011 User Meeting Workshops

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Workshops Print Home Agenda Awards Exhibitors Lodging Posters Registration Photo Contest Transportation Workshops This e-mail address is being protected from spambots. You need...

  16. 2012 User Meeting Agenda

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 User Meeting Agenda Print Agenda Home Agenda Awards Exhibitors Lodging Posters Registration Transportation Workshops This e-mail address is being protected from spambots. You...

  17. 2011 User Meeting Agenda

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Agenda Print Home Agenda Awards Exhibitors Lodging Posters Registration Photo Contest Transportation Workshops This e-mail address is being protected from spambots. You need...

  18. Image

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TONGATE Deputy Secretary CERTIFIED MAIL - RETURN RECEIPT REQUESTED February 17,2012 Jose R. Franco, Manager Carlsbad Field Office Department of Energy P. O. Box 3090 Carlsbad,...

  19. Beamline 11.0.2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scientific applications Surface chemistry, catalysts, environmental science. Experimental techniques XPS, NEXAFS Local contact This e-mail address is being protected from spambots....

  20. Albert Kang | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Albert Kang Albert Kang Albert Kang Graduate Student E-mail: h.kang@wustl.edu Website: Washington University in St. Louis Graduate Students...

  1. James Morby | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    James Morby James Morby James Morby James Morby Graduate Student E-mail: jmorby1@sheffield.ac.uk Website: University of Sheffield Graduate Students...

  2. Illinois/Wind Resources | Open Energy Information

    Open Energy Info (EERE)

    Contact Information Wayne Hartel Department of Commerce and Economic Opportunity James R. Thompson Center 100 W. Randolph, Suite 3-400 Chicago, Illinois 60601 E-mail:...

  3. ALSNews Vol. 304

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To subscribeunsubscribe, email This e-mail address is being protected from spambots. You need JavaScript enabled to view it . Proofreading RNA: Structure of RNA Polymerase...

  4. Energy Citations Database (ECD) - Alerts Help

    Office of Scientific and Technical Information (OSTI)

    Help Alerts Registration - Receiving Alerts - Renewing your registration Alerts Log On Changing E-mail Address ECD Alerts Contact Us Managing your Alerts - Requesting an Alert or...

  5. Alexsander Roszak | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alexsander Roszak Alexsander Roszak Alexsander Roszak Research Associate E-mail: alexsander.roszak@glasgow.ac.uk Website: University of Glasgow Research and Technical Associates

  6. Ali Erdemir | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ali Erdemir Argonne Distinguished Fellow News Argonne researchers win two R&D 100 Awards E-mail erdemir@anl.gov Website Argonne Experts Google Scholar

  7. Alper Kinaci | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Postdoctoral Appointee (Supervisor, Maria Chan) Alper Kinaci Telephone 630.252.5378 Fax 630.252.4646 E-mail akinaci

  8. Amelia Nguyen | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Amelia Nguyen Amelia Nguyen Amelia Nguyen Graduate Student E-mail: aynguyen@wustl.edu Website: Washington University in St. Louis Graduate

  9. Aparna Nagarajan | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aparna Nagarajan Aparna Nagarajan Aparna Nagarajan Postdoctoral Associate E-mail: aparna@wustl.edu Website: Washington University in St. Louis Postdoctoral Associates

  10. Atsuko Kanazawa | Photosynthetic Antenna Research Center

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Atsuko Kanazawa Atsuko Kanazawa Atsuko Kanazawa Research Assistant Professor E-mail: kanazawa@msu.edu Website: Michigan State University Research Affiliate Associates & Students

  11. Filing Information | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    We therefore encourage electronic filing of time-sensitive submissions. If you have any questions, please contact Fred Brown, Deputy Director, at (202) 287-1545. Mailing Address ...

  12. Laurie Bagley succeeds Lew Meixler as head of Technology Transfer...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    marketing mailings. Bagley has been married to her husband Dan, a toxicologist at Colgate Palmolive, for 25 years. The couple lives in Kendall Park in South Brunswick and...

  13. Femtosecond upconverted photocurrent spectroscopy of InAs quantum...

    Office of Scientific and Technical Information (OSTI)

    are studied for intermediate-band solar-cell applications via ultrafast ... Yoshihiko, E-mail: kanemitu@scl.kyoto-u.ac.jp 1 ; Japan Science and Technology ...

  14. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Fischer, Peter (2) Kronast, Florian (2) Streubel, Robert (2) Abrudan, Radu (1) Albrecht, ... Magnetization dynamics of imprinted non-collinear spin textures Streubel, Robert, E-mail: ...

  15. B R O O K H A V E N L E C T U R E SERIES Symmetry Principles in Physics

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    j j B J j s i u i u j p v U O H E I U J O J U I A B j e u g o i i o 3 r o a d \ > \ A O U 3 N 3 P Q Q I i s n B n y This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. AH telephone orders should be directed to: U.S. Government Printing Office Superintendent of Documents McPherson Square Bookstore U.S. Government Printing Office 1510 H Street, N.W. Washington, DC 20402

  16. Compliance With Floodplain and Wetland Environmental Review Requirements (10 CFR Parts 1021 and 1022) - FR Notice, August 27, 2003

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    section of the FEDERAL REGISTER contains regulatory documents having general applicability and legal effect, most of which are keyed to and codified in the Code of Federal Regulations, which is published under 50 titles pursuant to 44 U.S.C. 1510. The Code of Federal Regulations is sold by the Superintendent of Documents. Prices of new books are listed in the first FEDERAL REGISTER issue of each week. Rules and Regulations Federal Register 51429 Vol. 68, No. 166 Wednesday, August 27, 2003

  17. DOE HQ F 1410.2 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 DOE HQ F 1410.2 Form used to confirm receipt of controlled mail parcel service items. PDF icon RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE More Documents & Publications DOE HQ F 1410.8 DOE F 1324.5 DOE HQ F 1410.4

  18. DOE HQ F 1410.4 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 DOE HQ F 1410.4 Form used to track how long it takes a recipient to receive a mail item. PDF icon MAIL TIME SURVEY FORM More Documents & Publications DOE HQ F 1410.8 Correspondence Style Guide Acquisition Letters No. AL 2013-05

  19. BPA-2011-01336-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    t 206.4.664 f 206.62 624.80039 June 13, 2011 BY E-MAIL, FACSIMILE & FIRST CLASS MAIL U.S. Department of Energy Bonneville Power Administration Attn: Mr. Ray L. Byrd NSSF-4 905 NE...

  20. About Us | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Us About Us Department of Energy Facilities By E-mail: You can send an email to the Secretary of Energy at The.Secretary@hq.doe.gov By Phone: 202-586-5000 (Main Switchboard) or use the National Phone Directory For Hearing and/or Speech Impaired: Telephone Communication By Fax: 202-586-4403 *By Mail: U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 *Please note: mail may take up to 3 weeks to arrive. As such, we strongly encourage you to use the email address provided