National Library of Energy BETA

Sample records for 202-512-2104 mail superintendent

  1. U.S. GOVERNMENT PRINTING OFFICE WASHINGTON

    E-Print Network [OSTI]

    U.S. GOVERNMENT PRINTING OFFICE WASHINGTON : For sale by the Superintendent of Documents, U­1800 Fax: (202) 512­2104 Mail: Stop IDCC, Washington, DC 20402­0001 52­894PDF 2010 THE NEXT GENERATION WU, Oregon BRIAN BAIRD, Washington BRAD MILLER, North Carolina DANIEL LIPINSKI, Illinois GABRIELLE

  2. This page intentionally blank. ON THE COVER

    E-Print Network [OSTI]

    : NSPUE2 U.S. GOVERNMENT PRINTING OFFICE-WASHINGTON: 2011 For sale by the Superintendent of Documents, U.S. Government Printing Office Internet: bookstore.gpo.gov Phone: 1.866.512.1800 Fax: 202.512.2104 Mail: Stop Quantifying disorder in lipid membranes, M. Mihailescu, et al. 20 Neutronreflectometrystudiesofthe

  3. Five African American Male Superintendents and Their Leadership in Diverse School Districts in Texas 

    E-Print Network [OSTI]

    Smothers, Aneil 1968-

    2012-11-29

    Introduction .................................................................................... 52 The Equitable Superintendent?s Story ............................................ 54 The Indigenous Superintendent?s Story...

  4. District Superintendent and School Board President Perceptions Regarding Leadership Characteristics for Superintendents of Texas Schools 

    E-Print Network [OSTI]

    Groholski, Kenneth L.

    2010-07-14

    ABSTRACT District Superintendent and School Board President Perceptions regarding Leadership Characteristics for Superintendents of Texas Schools. (December 2009) Kenneth Lee Groholski, B.S., Sam Houston State University M.Ed., Tarleton State...

  5. MAIL DISTRIBUTION MAIL PRODUCTION

    E-Print Network [OSTI]

    MAIL DISTRIBUTION AND MAIL PRODUCTION OPERATIONS GUIDE November 07 Revised November 07 #12;2 Mail/billing......................................................................................1-5346 Mail Production of the University non-profit permit. 3. All bulk mailings must be coordinated with Mail Production at the earliest

  6. A comparison of management and leadership skills critical to the principalship as perceived by superintendents in selected independent school districts in Texas 

    E-Print Network [OSTI]

    White, Katherine Alia

    2006-04-12

    by gender and size of district. An e-mail was sent to each superintendent with a web address and an access code. A response rate of 66% was obtained for a sample size of 290 superintendents. The survey contained items on management and leadership skills from...

  7. Mailing Pubs 

    E-Print Network [OSTI]

    Unknown

    2011-08-17

    of service requirements of potential users; and potential input to WRSIC by users. Total number of organizations interviewed by mail and by personal visits was 726 and total number of persons interviewed was 128, mail Questionnaires were sent to 669...

  8. Superintendents' Perceptions Toward Their Current Role as Instructional Leaders 

    E-Print Network [OSTI]

    Garcia, Liodolee Salinas

    2012-10-19

    This study was conducted to identify the self-perceptions of superintendents regarding their instructional leadership practices. The focus of the research was to explore the linkages that exist between these perceptions and factors...

  9. Factors influencing the underrepresentation of women in the role of superintendency as perceived by selected school board members and superintendents of school districts in Region XX, Education Service Center in Texas 

    E-Print Network [OSTI]

    Barrios, Vivian S.

    2004-11-15

    School board members, superintendents, and assistant superintendents from Region XX, Education Service Center in Texas were surveyed to examine their perceptions regarding the underrepresentation of women in the role of superintendency. Individual...

  10. I Am a Chameleon In Pearls: How Three Select Female Superintendents Perceive Their Professional Lives 

    E-Print Network [OSTI]

    Ryan, Catherine

    2012-10-19

    The public school superintendent is the least progressive position in education at integrating women and balancing the scales of equitable representation. Statistical data indicates there are far fewer females than males serving as superintendents...

  11. Moral judgment and public school superintendents in Texas 

    E-Print Network [OSTI]

    Hope, Michael Wayne

    2009-05-15

    The purpose of this study was to examine moral judgment of public school superintendents in Texas when faced with moral dilemmas. The Defining Issues Test-2 was used to measure levels of moral judgment. A demographic survey was also used in order...

  12. A case study of the experiences of five former and current urban non-traditional superintendents 

    E-Print Network [OSTI]

    Sanchez, Maria Severita

    2009-05-15

    A growing number of traditional school boards and city mayors are looking for the next generation of school superintendents to come prepared with a variety of professional backgrounds to provide instructional leadership for school districts...

  13. An Analysis of Texas Superintendents' Bilingual/ESL Teacher Recruitment and Retention Practices 

    E-Print Network [OSTI]

    Lara-Alecio, Rafael; Galloway, Martha; Irby, Beverly J.; Brown, Genevieve

    2010-10-22

    teaching fairs for bilingual students. Begin early to recruit through these fairs, even at the sixth grade level. One superintendent in our study pointed out, ?Bilingual/ESL teachers are in great demand and merit much more recognition than school...=ISO-8859-1 Bilingual/ESL Teacher Recruitment/Retention 1 Running Head: BILINGUAL/ESL TEACHER RECRUITMENT/RETENTION An Analysis of Texas Superintendents? Bilingual/ESL Teacher Recruitment and Retention Practices Rafael Lara...

  14. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  15. Connecting the role of school superintendents to teaching and learning in schools: a research synthesis of three educational administration peer reviewed research journals between 1983-2006 

    E-Print Network [OSTI]

    Shidemantle, Steven Paul

    2008-10-10

    and to new connections that meet the increased responsibilities and complexities of the superintendents’ role. The thematic synthesis, reinforced by descriptive syntheses, indicated 15 separate superintendent – technical core constructs that promote new areas... supportive constructs from thematic synthesis results that provide connections between superintendents and teaching and learning in schools. ........................................................................................................ 102 31...

  16. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  17. The Influence of the Superintendent of Schools on Student Academic Performance 

    E-Print Network [OSTI]

    Hanks, Jeffrey M.

    2010-07-14

    was constructed in EQS. Loadings for each path in the model were analyzed. A CFA analysis, which was intended to test the measurement model of superintendent leadership practices, was conducted. A 50-item survey which was hypothesized to measure the six dimensions...

  18. Perceived superintendents' leadership and student performance in Region V Education Service Center: a cohort study 

    E-Print Network [OSTI]

    Brent, Fred Martin

    2007-09-17

    The intent of this study was to measure the perceived superintendents� leadership practices in relation to student performance on the Texas Assessment of Knowledge and Skills (TAKS) in Region V Education Service Center, Texas. This is one...

  19. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 OutreachProductswsicloudwsiclouddenDVA N C E D B L OBransenBusiness networking and coaching atMoneyBy E-Mail May

  20. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  1. AREAS OF KNOWLEDGE NEEDED BY SUPERINTENDENTS AND ARCHITECTS TO ENHANCE THEIR COLLABORATION IN THE SCHOOL DESIGN PROCESS 

    E-Print Network [OSTI]

    Lovesmith, Deanna M.

    2010-01-16

    The purpose of the study was to identify perceptions of the contributions made by superintendents and architects respectively when programming a new school. Areas of collaboration were determined by a qualitative analysis of the responses...

  2. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 OutreachProductswsicloudwsiclouddenDVA N C E D B L OBransenBusiness networking and coaching atMoney and Energy

  3. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home RoomPreservationBio-Inspired SolarAboutXu Named|Got Solitons? S andia's JuanLearn morellnl |Goals

  4. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTechtail.Theory ofDid youOxygen Generation |Publications TheGashome / Related LinksEnergySREL

  5. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefield Municipal GasAdministration Medal01 Sandia4) AugustA. -71- Particulate: ColumnsLake4/%2A

  6. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformationJesseworkSURVEYI/O Streams forOrhan Kizilkaya,P. Leslie Dutton0B ATLAS

  7. I United States Government Printing Office SUPERINTENDENT OF WCUMENTS

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefield Municipal Gas &SCE-SessionsSouth DakotaRobbins and MyersHr. Anthony V. Andolina: lHeader5s I

  8. Reflective Practice of a Hispanic Chief Financial Officer and Interim Superintendent in a Predominantly Hispanic South Texas School District 

    E-Print Network [OSTI]

    Amezcua, Jesus J.

    2014-12-10

    for superintendents and chief financial officers (CFOs) and the linking of Schön’s reflective practice with Mezirow’s transformative learning. Therefore, this study was aimed at examining my critical events and the use of reflective practice to improve professional...

  9. MAIL PREPARATION / POSTAGE FORM FSU MAIL PROCESSING CENTER

    E-Print Network [OSTI]

    McQuade, D. Tyler

    MAIL PREPARATION / POSTAGE FORM FSU MAIL PROCESSING CENTER TALLAHASSEE, FL 32306-0001 Description Piece Number Of Inserts [ ] Presorted Standard Number Of Tabs [ ] Campus Pieces To Be Folded [ ] Other stamp [ ] cheshire [ ] not in zip code order [ ] machinable [ ] hand [ ] Sorted by Postal soft

  10. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACTThousandReport) |AdministrationStanfordLabMail ManagementMail

  11. REDUCE UNWANTED MAIL IN YOUR DEPARTMENT To stop unwanted mail

    E-Print Network [OSTI]

    Gelfond, Michael

    Tear off the label, write your instructions on it, and enclose in the postage- paid ordering envelope can send the label to the sending company with the person's new address or let them know you do not want that mail. · Catalogs: o Call the company's 800 number and have the label information handy. o

  12. CSU Mail Production Center 6011 Campus Delivery

    E-Print Network [OSTI]

    CSU Mail Production Center 6011 Campus Delivery Phone: 970-491-6142 Fax: 970-491-5012 E-mail: mail.production@colostate.edu MAIL PRODUCTION SERVICE REQUEST CONTACT & BILLING INFORMATION Contact Person Name Mail Code Department Mail Date ** ** Allow up to 5 to 7 days from date materials are received by Mail Production. Inquiries

  13. The role of the superintendent as perceived by school administrators and school board presidents in Texas public schools in Region 20 ESC 

    E-Print Network [OSTI]

    Running, Peter John

    2005-02-17

    This study examined the role of the superintendent as it is perceived by school administrators and school board presidents. The study was limited to public schools in Texas located within Region 20 ESC. Responses to a Likert-type instrument were...

  14. Pricing via Processing Combatting Junk Mail \\Lambda

    E-Print Network [OSTI]

    Naor, Moni

    Pricing via Processing or Combatting Junk Mail \\Lambda Cynthia Dwork \\Lambda Moni Naor y Abstract be a deterrent; however, we do not want a system in which to send a letter or note between friends should have

  15. Pricing via Processing Combatting Junk Mail

    E-Print Network [OSTI]

    Naor, Moni

    Pricing via Processing or Combatting Junk Mail Cynthia Dwork Moni Naor y Abstract We present between friends should have a cost similar to that of a postage stamp; similarly we do not wish to charge

  16. This publication is available from the Superintendent of Documents, U.S. Governm

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming963 1.969 1.979 1.988Prices,Flight Paths30,2,8, 2015 | Next2, 2015January

  17. This publication is available from the Superintendent of Documents, U.S. Governm

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming963 1.969 1.979 1.988Prices,Flight Paths30,2,8, 2015 | Next2,

  18. Printing and Mail Managers Exchange Forum Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergyPresidential PermitDAYSDepartment of EnergyAct (PAA) provides Mail

  19. Printing and Mail Managers Exchange Forum Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergyPresidential PermitDAYSDepartment of EnergyAct (PAA) provides Mail

  20. Printing and Mail Managers Exchange Forum Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergyPresidential PermitDAYSDepartment of EnergyAct (PAA) provides Mail3

  1. April 23, 2004 BY ELECTRONIC MAIL

    E-Print Network [OSTI]

    entitled: "Council Recommendations for the Future Role of the Bonneville Power Administration in Power. A fundamental change in how Bonneville carries out its role in power supply: We whole- heartedly agreeApril 23, 2004 BY ELECTRONIC MAIL Northwest Power Planning Council 851 S.W. Sixth Ave., Suite 1100

  2. UNO Student ID Number__________________________________________________________________ Permanent Mailing Address________________________________________________________________

    E-Print Network [OSTI]

    Li, X. Rong

    UNO Graduate Other adult occupants must be either a spouse, domestic partner, or a relative that is a full-time UNO student and at least 21 years old at the time of application. If applicable, a copy.00. Personal Information Other Adult Occupant LAST FIRST MIDDLE Mailing Address: UNO Office of Student Housing

  3. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematics AndBeryllium Disease | Department of0 Inspection BEFORE9 -Lower ColoradoMOJAVE MOJAVE PDFProducts

  4. NAME ORGANIZATION E-MAIL PHONE

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterested Parties -Department of EnergyNEW YORK STATE ELECTRIC &USERoster-DOE

  5. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuels Data CenterFinancialInvesting in Minority BanksMANHATTAN PROJECTMail and

  6. Field Facilities Contacts for Printing and Mail

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy A plug-inPPLforLDRD Report to CongressApril 6, 2012Certification |FieldFacilities

  7. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on QA:QA J-E-1 SECTION JEnvironmental Jump to:EA EISTJThinWarsaw,What IsLogoCloud Jump to: navigation, searchsource

  8. Designing Flat Mail --Contents Publication 63, May 1995

    E-Print Network [OSTI]

    Shapiro, Benjamin

    Designing Flat Mail -- Contents Publication 63, May 1995 CONTENTS 1. OVERVIEW 2. UNDERSTANDING FLAT ­ POSTAL BUSINESS CENTERS #12;Publication 63, Designing Flat Mail (May 1995) Contents 1-- Overview

  9. The University of Texas at Austin University Electronic Mail Student Notification Policy (Use of E-mail for Official Correspondence

    E-Print Network [OSTI]

    Patzek, Tadeusz W.

    The University of Texas at Austin University Electronic Mail Student Notification Policy (Use of E of Texas at Austin. Official communications using e-mail can include e-mail to a group, such as all The University of Texas at Austin 3. E-mail Addresses Every student must provide the University with his or her

  10. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  11. Last Name First Name Ext. Access E-mail Last Name First Name Ext. Remote Access E-mail

    E-Print Network [OSTI]

    Columbia University

    Last Name First Name Ext. Remote Access E-mail Last Name First Name Ext. Remote Access E-mail Adamo-781-7186 jsquires Ghani Saleh 8979 sghani Strom David 8938 dstrom Gitelman Yitzhak 8943 ygitelma Sydor Elisabeth

  12. SOUTH CAMPUS APARTMENT RESIDENTS Package and Mail Delivery Information

    E-Print Network [OSTI]

    McConnell, Terry

    SOUTH CAMPUS APARTMENT RESIDENTS Package and Mail Delivery Information Upon check-in you mailbox will be labeled with your building number and apartment number. Example: 311 Chinook Dr Apt 4 will be labeled 311-4. Mail is delivered and handled by the United States Postal Service, USPS, for all

  13. Mining writeprints from anonymous e-mails for forensic investigation

    E-Print Network [OSTI]

    Fung, Benjamin C. M.

    University, Montreal, Quebec, Canada H3G 1M8 a r t i c l e i n f o Article history: Received 18 December 2009Mining writeprints from anonymous e-mails for forensic investigation Farkhund Iqbal*, Hamad to special characteristics of e-mail dataset. In this paper, we focus on the problem of mining the writing

  14. E-mail et Web : pour une navigation sans risque

    SciTech Connect (OSTI)

    None

    2010-06-28

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l’utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  15. Marcelo Godoy Simes e-mail: msimoes@mines.edu

    E-Print Network [OSTI]

    Simões, Marcelo Godoy

    1 Marcelo Godoy Simões e-mail: msimoes@mines.edu webpage: http://inside.mines.edu/~msimoes, http://aceps for Advanced Control of Energy and Power Systems ­ ACEPS and is currently spearheading the new Colorado

  16. Yahoo! My Yahoo! Mail Sign Up -News Home Help

    E-Print Network [OSTI]

    Yahoo! My Yahoo! Mail Search New User? Sign In Sign Up -News Home Help Street Address: Zip Code: Go Reward for Virus (AP) AFP/File Photo Missed Tech Tuesday? Technology is changing sports-- . Plus, tech

  17. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  18. Mailing Address: Center for Energy and Environmental Policy

    E-Print Network [OSTI]

    Delaware, University of

    justice, conservation and renewable energy options, integrated resource planning, and technology-Electric..................................................................................... 20 2. A Comparative Analysis of Solar and Non-Solar Energy Costs#12;ii Mailing Address: John Byrne Director Center for Energy and Environmental Policy University

  19. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration wouldMassR&D100 Winners * Impacts on GlobalRachel2RateCaseElementsOxide FuelRead Your E-mail

  20. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACTThousandReport) |AdministrationStanfordLabMail Management

  1. Postdoctoral Researcher e-mail: jiaqil81@gmail.com

    E-Print Network [OSTI]

    Liu, Feng

    -mail: fliu@uci.edu Multipoint Design Optimization of a Transonic Compressor Blade by Using an Adjoint Method of the number of design parameters. NASA Rotor 67 is redesigned through blade profiling. A single point design as the objective function. The design results are presented in detail and the effects of blade profiling

  2. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCEDInstallers/ContractorsPhotovoltaicsState of Pennsylvania U.S.The First Five Years

  3. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof Energy Services » ProgramPolicy andResearch &FellowshipsField

  4. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof Energy ServicesContracting OversightEMS Policy HQ EMSHarnessEnergy

  5. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof EnergyApril 2014 |Department of Energy MA3T Model

  6. Minutes from the Print and Mail Managers Exchange Forum Teleconferences |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof EnergyApril 2014 |Department ofMay

  7. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing and

  8. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing and0,

  9. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing

  10. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing

  11. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing

  12. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,

  13. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,

  14. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,

  15. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  16. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  17. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  18. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  19. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  20. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergy AEnergy Managing SwimmingMicrosoft Word1 2 - 2 0 1 5Department of Printing8,7,10

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:Financing ToolInternationalReport FY2014 -EnergyEnergy 1: systems analysis O F4May, Focus

  2. Public Comments Submitted by E-mail | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration wouldMass mapSpeedingProgramExemptionsProtein Dynamics HitPseudogapBenefits of ASCR »Public

  3. Mailing Addresses for National Laboratories and Technology Centers |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: Alternative Fuelsof EnergyApril 2014 |Department of Energy MA3T ModelDepartment of

  4. Manager Group Name Location Name Title Contact E mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power Administration would likeUniverseIMPACTThousandReport)Price (Dollars8-2011. Management's1-25-2013.Manager Group

  5. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel13 1.919The U.S. using

  6. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel13 1.919The U.S.

  7. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel13 1.919The

  8. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel13 1.919Thejsp."

  9. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel13

  10. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel135.5 or later or

  11. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel135.5 or later

  12. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel135.5 or later using a

  13. This form may be submitted to the EIA by mail, fax, e-mail, or secure file trans

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page| Open Energy Informationmonthly gasoline price to fall to $3.43U.S. Coke515 2.494 2.484Biodiesel135.5 or later using

  14. Configuring ICEMail for Apple Mail for MacOS 10.10 Yosemite

    E-Print Network [OSTI]

    Chen, Yiling

    Configuring ICEMail for Apple Mail for MacOS 10.10 Yosemite Once you have received notification on at https://icemail.harvard.edu, you will need to add the new settings in Apple Mail. Step 1. Launch Mail the Accounts tab. And click on the + in the lower left corner. (See Figure 2) Figure 2 SEAS-ICE Apple Mail

  15. Name Affiliation Photo Local Contact Local e-mail Organizational e-mail Required training Aravindakshan, Ajay Indian Inst. of Sci.

    E-Print Network [OSTI]

    Laboratory Stephen Springston 631-344-4477 srs@bnl.gov prijithsudhakar@gmail.com Zhang, Qi UC Davis Stephen Springston 631-344-4477 srs@bnl.gov dkwzhang@ucdavis.edu Xu, Jianzhong UC Davis Stephen Springston 631-mail Organizational e-mail Required training Behrens, Bill BNL 631-344-2906 behrens@bnl.gov Milian, Larry BNL 631

  16. Introduction To configure Apple Mail to access your University student email account

    E-Print Network [OSTI]

    Balasuriya, Sanjeeva

    Introduction To configure Apple Mail to access your University student email account Procedure 1 8313 3000 or servicedesk@adelaide.edu.au Technology Services Configure Student Gmail - Apple Mail #12;

  17. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  18. Canning the spam: Is There a Case for Legal Control of Junk Electronic Mail

    E-Print Network [OSTI]

    Edwards, Lilian

    2000-01-01

    Paper presented by Edwards on 'Canning the spam: Is there a case for legal control of junk electronic mail?', 2000.

  19. Journal of Applied Polymer Science Journal Copy of e-mail Notification

    E-Print Network [OSTI]

    Journal of Applied Polymer Science Journal Copy of e-mail Notification Journal of Applied Polymer reply e-mail to: APP Journal Team APPproofuser@wiley.com #12;Journal of Applied Polymer Science Journal) WITH ALL CORRESPONDENCE. Thank you. Sincerely, APP Journal Team E-mail: APPproofuser@wiley.com #12

  20. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  1. OUTLOOK MAIL MERGE QUICK REFERENCE GUIDE 1 Copyright Swinburne University of Technology Updated 4

    E-Print Network [OSTI]

    Liley, David

    OUTLOOK ­ MAIL MERGE QUICK REFERENCE GUIDE 1 Copyright ©Swinburne University of Technology Updated 4 th September 2012 Mail merge is a feature of Outlook and Word that allows you to send: From Outlook using your Outlook contacts 1. In the Contacts view, select the names of the Contacts you

  2. Reply to "Heart Position in Snakes" * E-mail: ggart001@ucr.edu.

    E-Print Network [OSTI]

    Saltzman, Wendy

    102 Reply to "Heart Position in Snakes" * E-mail: ggart001@ucr.edu. E-mail: jhicks@uci.edu. E/16/2010 ABSTRACT In a previous paper comparing 155 species of snakes, we showed that the position of the heart, ecology, and heart position in snakes," Physiological and Biochemical Zoology 83:43­54). More specifically

  3. INTEROPERABILITY AND PERFORMANCE ISSUES IN HF E-MAIL Eric E. Johnson

    E-Print Network [OSTI]

    Johnson, Eric E.

    INTEROPERABILITY AND PERFORMANCE ISSUES IN HF E-MAIL Eric E. Johnson New Mexico State University exceed those experi- enced in the wired Internet. Beyond the delays imposed by low data bandwidths network.) · The Simple Mail Transfer Protocol SMTP [RFC-821] is the standard within the Internet. Its

  4. e-mail: hcao@uta.edu J.-C. Chiao

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    cause difficulties in recording and interpreting, which has been a technical chal- lenge in existingHung Cao e-mail: hcao@uta.edu J.-C. Chiao e-mail: jcchiao@uta.edu Department of Electrical signals electric currents in the range of picoamperes in electrochemical approaches utilizing MEA could

  5. Sanjaya K. Pradhan e-mail: spradh1@uic.edu

    E-Print Network [OSTI]

    Mazumder, Sudip K.

    Hartvigsen e-mail: jjh@ceramatec.com Michele Hollist e-mail: mhollist@ceramatec.com SOFC and Hydrogen. Several studies have addressed the issues related to the reliabil- ity of SOFC. Effects of higher operating temperature and high fuel utilization on the material properties of SOFC have been reported

  6. 1. Open up Apple Mail. If you do not have a non Barnard email account already configured in Apple Mail you can skip to step 2. If you already have a different email

    E-Print Network [OSTI]

    1. Open up Apple Mail. If you do not have a non Barnard email account already configured in Apple. Then hit the "+ "symbol to add a new account. If you already have a Barnard account set up in Apple Mail will be set up in Apple Mail. 5. From within the Apple Mail program, click "Mail" at the top

  7. Written emotional expression and health: efficacy of treatment implementation via mail 

    E-Print Network [OSTI]

    Brown, Erin Leigh

    2013-02-22

    not found to impact treatment effectiveness. Participants in the treatment condition exhibited better health outcomes overall than participants in the control condition. The study's results suggest that even when administered through e-mail, the emotional...

  8. , 2004, 30, . 21 12 E-mail: http://www.pnpi.spb.ru/

    E-Print Network [OSTI]

    Titov, Anatoly

    , 2004, 30, . 21 12 02 © .. , .. , .. , .. , .. .- . .. E-mail: http://www.pnpi.spb.ru/ 22 2004 . P- . , P- - . , P- , , 1% 1-. (400 ÷ 4000) Gs , P- . , M1-1 . 1 . . , 2004, 30, . 21 #12

  9. Advertise on NYTimes.com SIGN IN TO E-MAIL OR

    E-Print Network [OSTI]

    Columbia University

    Advertise on NYTimes.com SIGN IN TO E-MAIL OR SAVE THIS PRINT SHARE Related A Whiff of Naples. Advertise on NYTimes.com Go to Complete List » More Articles in Opinion » MOST POPULAR Michelle Obama Looks

  10. Information Please return to ITS Support Center, Mail Stop: ITS Kerr University Administrative Information System

    E-Print Network [OSTI]

    California at Santa Cruz, University of

    Information Please return to ITS Support Center, Mail Stop: ITS Kerr Technology Services University Number Records Retention Information: Information Technology Services Retention Period: 5 years after Administrative Information System ACCESS TO INFORMATION STATEMENT Federal law, California law, and University

  11. Duplicate diploma fee charged to BruinBill account E-mail address required below

    E-Print Network [OSTI]

    Williams, Gary A.

    country city state Zip/Postal code Province (canada only) Telephone e-mail Address Birthdate 9-Digit Ucl that the duplicate diploma will bear the signatures of the current officials of the state and the University. #12;

  12. INTEGRATIVE BIOLOGY "GO-TO" LIST ITEM CONTACT PERSON PHONE E-MAIL OFFICE

    E-Print Network [OSTI]

    Lajeunesse, Marc J.

    Assistants United Christy Foust christyfoust@mail.usf.edu Rules & Logistics Christine Brubaker (Grad-2628 or cksteffan@usf.edu orehaller@usf.edu MAINTENANCE SHOP Clint Steffan 4-2667 cksteffan@usf.edu ISA 1032 #12

  13. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  14. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effectWorkingLosThe23-24, 2011Science (SC) RedefiningSign Up for E-mail Updates

  15. "Today, people send lots of protected e-mail. [Active Directory Rights

    E-Print Network [OSTI]

    Narasayya, Vivek

    , and in e-mails. Users need access to this information from everywhere, to share it where appropriate information leakage, enterprise infrastructure needs to be secured and information must be discovered Microsoft Forefront has brought together the essential capabilities needed to provide an integrated solution

  16. AISEC: an Artificial Immune System for E-mail Classification Andrew Secker

    E-Print Network [OSTI]

    Timmis, Jon

    of continuous learning for the purposes of two-class classification and is illustrated here on the taskAISEC: an Artificial Immune System for E-mail Classification Andrew Secker Computing Laboratory-interesting without the need for re-training. Comparisons are drawn with a naïve Bayesian classifier and it is shown

  17. Banks, credit-card issuers warn of e-mail breach By LAURA GREEN

    E-Print Network [OSTI]

    Fernandez, Eduardo

    ' credit card numbers, for example, were hacked, said Roy Levow, Florida Atlantic University computer carefully read any messages that appear to come from your bank. The affected businesses include Capital One business. Hover your arrow over the link in the e-mail and the address will show up, Levow said. If the web

  18. J. A. Harding e-mail: j.a.harding@lboro.ac.uk

    E-Print Network [OSTI]

    Kusiak, Andrew

    management, and knowledge engineering are currently topics of importance to manufacturing researchers and managers intent on exploiting current assets. Database technology is central to all these knowledge-mail: s.srinivas@lboro.ac.uk Wolfson School of Mechanical and Manufacturing Engineering, Loughborough

  19. Internet Outages, the Eyewitness Accounts: Analysis of the Outages Mailing List

    E-Print Network [OSTI]

    Sekar, Vyas

    Internet Outages, the Eyewitness Accounts: Analysis of the Outages Mailing List Ritwik Banerjee and outages is critical to the "health" of the Internet infrastructure. Unfortunately, our ability to analyze. In this paper, we leverage a somewhat unconventional dataset to analyze Internet reliability--the outages

  20. * Corresponding author. E-mail address: dengx@physics.utoledo.edu (X. Deng)

    E-Print Network [OSTI]

    Deng, Xunming

    * Corresponding author. E-mail address: dengx@physics.utoledo.edu (X. Deng) Solar Energy Materials & Solar Cells 62 (2000) 89}95 Amorphous silicon and silicon germanium materials for high-e$ciency triple-Si/a-SiGe/a-SiGe solar cells with 10.6% initial e$ciency. 2000 Elsevier Science B.V. All rights reserved. Keywords: a

  1. Joint Mail-In Rebate Decisions in Supply Chains Under Demand Uncertainty

    E-Print Network [OSTI]

    Geng, Qin; Mallik, Suman

    2010-01-01

    We study the joint decisions of offering mail-in rebates (MIRs) in a single-manufacturer–single-retailer supply chain using a game theoretic framework. Either party can offer an MIR to the end consumer if it is in his best interest. The consumer...

  2. Journal of Nanotechnology in Engineering and Medicine Journal Copy of e-mail Notification

    E-Print Network [OSTI]

    Mukhopadhyay, Sharmila M.

    Journal of Nanotechnology in Engineering and Medicine Journal Copy of e-mail Notification Journal accepted for publication in the ASME Journal Program. Your page proof is available in PDF format from. If you have any questions, please contact: asme.cenveo@cenveo.com. Sincerely, Sin Yi Yeung, Journal

  3. NATURAL GAS ADVISORY COMMITTEE 2013-2015 Name Affiliation Phone E-mail Sector

    E-Print Network [OSTI]

    NATURAL GAS ADVISORY COMMITTEE 2013-2015 Name Affiliation Phone E-mail Sector Cocks, Michael BPA Natural Gas (503) 721-2475 randy.friedman@nwnatural.com Distribution Finklea Edward NW Ind. Gas Users (503@ci.tacoma.wa.us Electric Utility Defenbach, Byron Intermountain Gas (208) 377-6080 bdefen@intgas.com Distribution Dahlberg

  4. NATURAL GAS ADVISORY COMMITTEE 2013-2015 Name Affiliation Phone E-mail Sector June 7

    E-Print Network [OSTI]

    NATURAL GAS ADVISORY COMMITTEE 2013-2015 Name Affiliation Phone E-mail Sector June 7 meeting Cocks Friedman, Randy NW Natural Gas (503) 721-2475 randy.friedman@nwnatural.com Distribution Finklea Edward NW-8553 bdickens@ci.tacoma.wa.us Electric Utility Defenbach, Byron Intermountain Gas (208) 377-6080 bdefen

  5. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Kalueff, Allan V.

    of Tampere, c Department of Clinical Chemistry, Tampere University Hospital, Tampere, Finland ence between Audiology Jing Zou Department of Otolaryngology, School of Medicine University of Tampere, FM1, 3rd Floor, Biokatu 6 FI­33520 Tampere (Finland) Tel. +358 3 3116 4129, Fax +358 3 3551 771, E-Mail Jing

  6. Internet: http://ue.eu.int E-mail: press.office@consilium.eu.int

    E-Print Network [OSTI]

    Internet: http://ue.eu.int E-mail: press.office@consilium.eu.int For further information call 32 2 references are given in the text are available on the Council's Internet site http://ue.eu.int. Acts adopted; these statements are available on the above mentioned Council Internet site or may be obtained from the Press

  7. Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int

    E-Print Network [OSTI]

    Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int For further information call 32 2 marks. The documents whose references are given in the text are available on the Council's Internet Internet site or may be obtained from the Press Office. #12;PROVISIONAL VERSION 11.III.2004 6648/04 (Presse

  8. Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int

    E-Print Network [OSTI]

    Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int For further information call 32 2. The documents whose references are given in the text are available on the Council's Internet site http by an asterisk; these statements are available on the above mentioned Council Internet site or may be #12;22.IX

  9. E-mail: hendrik-jan.veen@tuebingen.mpg.de Psychophysical Experiments on the Internet

    E-Print Network [OSTI]

    E-mail: hendrik-jan.veen@tuebingen.mpg.de Psychophysical Experiments on the Internet Hendrik participated in one or more web-experiments. A comparison between the results of the anonymous Internet the anonymous Internet subjects (the main subject group). Members of the lab participating in web

  10. Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int

    E-Print Network [OSTI]

    Internet: http://ue.eu.int/ E-mail: press.office@consilium.eu.int For further information call 32 2. A The documents whose references are given in the text are available on the Council's Internet site http by an asterisk; these statements are available on the above mentioned Council Internet site or may be obtained

  11. Techniques for Identifying the Country Origin of Mailing List Participants Dept. of Elec. and Comp. Eng.

    E-Print Network [OSTI]

    Zou, Ying

    these projects and in shaping their implementation structure (i.e., design and architecture). In this paper, we of the mailing list for open source projects is international. However, prior work uses estimation techniques lists play a central role in facilitating communication in open source projects. Participants from

  12. Non-Monotonic-Offers Bargaining Protocol PINATA WINOTO piw410@mail.usask.ca

    E-Print Network [OSTI]

    Vassileva, Julita

    Non-Monotonic-Offers Bargaining Protocol PINATA WINOTO piw410@mail.usask.ca Department of Computer, Canada Abstract. This paper concerns the strengths and weaknesses of non-monotonic-offers in alternating-offer bargaining protocols. It is commonly assumed that bargainers submit monotonic offers over time corre

  13. 2/11/02 ISEE Annual Meeting bstump@mail.smu.edu

    E-Print Network [OSTI]

    Stump, Brian W.

    developed for contained single-fired explosions in a coal mine. · Regional seismograms (100's km) support Source Scaling of Single-Fired and Delay-Fired Explosions #12;2/11/02 ISEE Annual Meeting Feb 2002 bstump@mail.smu.edu Types of Explosions Contained, Single-Fired: Cylindrical borehole with enough stemming to maintain

  14. Android Diabetes Log Book E-mail: kongkamol@kku.ac.th

    E-Print Network [OSTI]

    Runapongsa, Kanda

    Android Diabetes Log Book 1 2 3 1 . . 40002 2, 3 . . 40002 E-mail: kongkamol@kku.ac.th Abstract. Generally, the patients record their health conditions in patients' log book. An android application had. Keywords: android application, diabetes 4.07 5.00 , 1. 285 . . 2573 435 . . 2552 558,156 7,019 [1] 15 7% [2

  15. Add me to your mailing list for future information about energy management courses.

    E-Print Network [OSTI]

    California at Davis, University of

    management control systems, natural gas purchasing opportunities in the spot market, thermal energy storage, alternative energy supplies, energy security and energy trading. Explore reliability and risk analysis methodsAdd me to your mailing list for future information about energy management courses. Name Job Title

  16. Subscribe Today to E-mail Alerts from GTO | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCED MANUFACTURINGEnergyPlan | Department of Energy 1Department ofLithium FYSubscribe Today to

  17. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematics And Statistics » USAJobs Search USAJobs SearchWater-SavingofCode | Department

  18. Great Republic: a historical and archaeological analysis of a Pacific mail steamship 

    E-Print Network [OSTI]

    Roberts, Andrew Philip

    2009-05-15

    -completion of the transcontinental railroad, the United States of America was in a position to take control of trade to the Far East. Once the railroad was complete, an established line of steamships finished the route from the eastern seaboard to the Far East. This route... of the transcontinental railway in 1869, the United States became the dominant power in the Asian market. Great Republic was a product of this movement. Built in 1866 as the premier steamship of the Pacific Mail Steamship Company?s China route, Great Republic...

  19. Customer Feedback during Development of 1998 MECS: Mail/Electronic Survey

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming963 1.969 1.979Coal4Cubic Feet)Cubic1992Thousand 2010

  20. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTechtail.Theory ofDid you notHeat PumpsTechnologiesTechnologies |Reviews

  1. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefieldSulfateSciTechtail.Theory ofDid you notHeat PumpsTechnologiesTechnologies |ReviewsAnalogues Comprising

  2. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i pStateDOEAnalysis,Department ofEnergy Community Power Works Project

  3. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l DeInsulation at theEnergy StateSpecifiers | Department ofis

  4. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l DeInsulation at theEnergy StateSpecifiers | Department ofis By

  5. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l DeInsulation at theEnergy StateSpecifiers | Department ofis

  6. CERTIFIED MAIL RETURN RECEIPT REQUESTED Dr. Chi-Chang Kao Laboratory Director

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirleyEnergyTher i n c i p a l DeInsulation at04-86) (AllProvision for FYs 2012 and 2013Dr.

  7. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankADVANCEDInstallers/ContractorsPhotovoltaicsStateof Energy| Department ofAttacks2324.12 (08-94)HQ F

  8. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformationJesseworkSURVEY UNIVERSE The 2014Capabilities ORISEandMaking aContact Us

  9. U.S. Postal Service General Mail Facility, San Diego, California |

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowing YouNeedof Energy Fish and Wildlifeof

  10. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustmentsShirley Ann Jackson About1996HowFOAShowingFuel Efficiency &Report | DepartmentVenueNovember 1,

  11. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity ofkandz-cm11 Outreach Home Room NewsInformationJessework usesof EnergyY-12 NationalNO FEAR Act Notice NO FEAR ActHighNOTICE

  12. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix B:

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming Dry Natural GasNaturalOctober 2015 Alcohol. TheData -1 IdleReport

  13. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of Natural GasAdjustments (Billion Cubic Feet) Wyoming Dry Natural Gas ReservesAlabamaAboutTotal Energymonthly

  14. Change of Address/ Name form Please complete all fields below and mail, fax or deliver to the Registrar's Office.

    E-Print Network [OSTI]

    Chapman, Michael S.

    of the Registrar Mail code L-109, Mackenzie Hall 1120 3181 SW Sam Jackson Park Rd. Portland, OR 97239 503

  15. Arizona Geological Society Digest 22 e-mail: Dorsey: rdorsey@uoregon.edu; LaMaskin: tlamaski@uoregon.edu

    E-Print Network [OSTI]

    Dorsey, Becky

    Arizona Geological Society Digest 22 2008 325 e-mail: Dorsey: rdorsey@uoregon.edu; La evolution, and ore deposits: Arizona Geological Society Digest 22, p. 325-332. Mesozoic collision

  16. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantity of NaturalDukeWakefield Municipal GasAdministration Medal ofNational NuclearSite Office Contracting Officer E-mail address

  17. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    egncalcom eightplus eightgev eng-div epicsusers farmsupport fel fewbody fsd g6clas guncntr gunwrk halbbpm halbbpmarchive hallldr halla hallamin hallaminarchive...

  18. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CEBAF Fast Shut Down System Back to Subscription Form G g6clas: No description available guncntr: Accelerator Gun Controls interest Group gunwrk: Accelerator Gun Controls working...

  19. CURRICULUM VITAE Mailing Address

    E-Print Network [OSTI]

    Hong, Don

    University (ETSU), Johnson City, TN. 05/2003 ­ 08/2005 Visiting Professor, Biostatistics, VU, Nashville, TN, Nashville, TN. 08/1999 ­ 07/2003 Associate Professor, Department of Math, ETSU, Johnson City, TN. 09/1996 ­07/1999 Assistant Professor, Mathematics, ETSU, Johnson City, TN. 09/1994 ­ 08/1996 Instructor

  20. CURRICULUM VITAE Mailing Address

    E-Print Network [OSTI]

    Hong, Don

    University (ETSU), Johnson City, TN 05/2003 ­ 08/2005 Visiting Professor, Biostatistics College of Medicine of Mathematics Vanderbilt University, Nashville, TN. 08/1999 ­ 07/2003 Associate Professor, Mathematics, ETSU, Johnson City, TN 09/1996 ­ 07/1999 Assistant Professor, Mathematics, ETSU, Johnson City, TN 09/1993 - 08

  1. *Corresponding author, E-mail: ndelucca@nd.edu The Airborne Aero-Optics Laboratory, Recent Data

    E-Print Network [OSTI]

    Gordeyev, Stanislav

    *Corresponding author, E-mail: ndelucca@nd.edu The Airborne Aero-Optics Laboratory, Recent Data, Notre Dame, IN USA 46556 ABSTRACT In this paper recent in-flight aero-optical measurements on the Airborne Aero-Optics Laboratory (AAOL) will be given. Instrumentation and experimental set

  2. Offices Phone FAX E-mail Room Ocean Department Secretary 67633 69225 catalpa@hawaii.edu 205

    E-Print Network [OSTI]

    Wang, Yuqing

    Offices Phone FAX E-mail Room Ocean Department Secretary 67633 69225 catalpa@hawaii.edu 205 Office Manager 69937 69225 ppetras@hawaii.edu 205D Student Assistants 67633 69225 ocean@soest.hawaii.edu 205 OCN 201 T.A.'s Office 67630 69225 ta@soest.hawaii.edu 113 Biological Ocean Division 67822 alawyer@hawaii

  3. Release of Information Mail/deliver to: Boise State University Registrar's Office, 1910 University Drive, Boise, ID 83725-1365

    E-Print Network [OSTI]

    Barrash, Warren

    Release of Information Mail/deliver to: Boise State University Registrar's Office, 1910 University Drive, Boise, ID 83725-1365 FAX: (208) 426-3169 Boise State University will not release any information. This Release of Information form will stay in effect until you rescind it in writing. To Permit the Release

  4. Personal Web Archive: E-mail: waka@iplab.cs.tsukuba.ac.jp, {shizuki,jiro}@cs.tsukuba.ac.jp

    E-Print Network [OSTI]

    Tanaka, Jiro

    Personal Web Archive: Web E-mail: waka@iplab.cs.tsukuba.ac.jp, {shizuki,jiro}@cs.tsukuba.ac.jp Web Web Web Web Web Web Personal Web Archive Personal Web Archive: Support System for Browsing the Versions of Web Page Ryota WAKAMATSU Buntarou SHIZUKI Jiro TANAKA Graduate School of Systems

  5. Experience us with dark theme 0 comments TweetTweet 12 3 0ShareShare TEXT SIZEE-MAIL

    E-Print Network [OSTI]

    Trainor, Laurel J.

    Experience us with dark theme 0 comments TweetTweet 12 3 0ShareShare TEXT SIZEE-MAIL Bouncing been facing the baby then performed several simple tasks #12;Around the web 5 Nice Things Guys Do in Sexual ... 1 comment · 2 days ago Joe -- I'm astonished that a web site that bills itself "science world

  6. From: Office of Information Technology No-Reply@ccny.cuny.edu Subject: IMPORTANT E-MAIL ALERT!

    E-Print Network [OSTI]

    Sun, Yi

    %address%seems%legi=mate%but%if%you%mouse%over%it%you%will%reveal%an e9mail%address%that%should%arouse%your%suspicion.%In%this%case%the%actual% accounts% (e.g. email,%Facebook,%bank%accounts,%etc.).%These%aFacks%can%lead%to%iden=fy%the[. Instead

  7. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on DeliciousMathematicsEnergyInterested Parties - WAPAEnergy May2.docTechnicalBARACK07ABB and Energy

  8. Impostazioni Google Apps con client Mail di Apple Mac per l'account di fantasia pinco.panco@uniroma1.it

    E-Print Network [OSTI]

    Di Pillo, Gianni

    Impostazioni Google Apps con client Mail di Apple Mac per l'account di fantasia pinco è ospitato sui server google.com) #12;Impostazioni Google Apps con client Mail di Apple Mac per l Google Apps con client Mail di Apple Mac per l'account di fantasia pinco.panco@uniroma1.it Pag. 3

  9. NAME COURSE Amin, Khalid kba561@mail.usask.ca (306) 262-4489 All Statistics Courses, Math 104/110

    E-Print Network [OSTI]

    Peak, Derek

    NAME COURSE Amin, Khalid kba561@mail.usask.ca (306) 262-4489 All Statistics Courses, Math 104/110 Anez, Federico fea379@mail.usask.ca (306) 262-2730 ALL Statistic level classes Anvari, Vahid anvari@math.usask.ca ALL Math courses and any 1st or 2nd yr. Statistics classes Assaf, Samer Ska680@mail.usask.ca (306

  10. Virginia Tech News Daily E-mail Policy Page 1 of 2 Virginia Polytechnic Institute and State University No. 12200 Rev.: 0

    E-Print Network [OSTI]

    -mail as the primary source through which all university communications will be channeled. Departments who wish announcements and campus notices to all university employees. 2. Policy Electronic delivery of information via e-mail has become the primary vehicle for internal communications at Virginia Tech. However, while e

  11. Microorganism Cleans Up Toxic Groundwater Search news.nationalgeographic.com Sign up for our free e-mail newsletter Also see: Today's Top Stories

    E-Print Network [OSTI]

    Lovley, Derek

    into groundwater. Above: a radioactive waste storage facility. Photograph by Emory Kristof, copyright National-mail newsletter Also see: Today's Top Stories This Story Environment - Related Sites & Stories - E-mail this story & Culture The Environment Travel National Geographic Channel Special Series Emerging Explorers Travel

  12. Phone: (765) 494-5146 E-mail: environment@purdue.edu Web: http://www.purdue.edu/DP/environment Center for the Environment

    E-Print Network [OSTI]

    " Phone: (765) 494-5146 · E-mail: environment@purdue.edu · Web: http overlapping aspects of the environmental challenges facing the world today. By emphasizing the deep connection-making and behavior #12;" " Phone: (765) 494-5146 · E-mail: environment@purdue.edu · Web: http

  13. Home Browse by Subject Bestsellers New Titles Editor's Choice New Reviews Textbooks Search Book Series Study Guides Rights Inspection Copy Contact Us Join Our Mailing List

    E-Print Network [OSTI]

    Carbone, Alessandra

    Series Study Guides Rights Inspection Copy Contact Us Join Our Mailing List For Authors How to Order E Journals Join Our Mailing List PATTERN FORMATION IN BIOLOGY, VISION AND DYNAMICS by Alessandra Carbone, plants, insects, seashells, and even the human brain. This volume comprises surveys of different aspects

  14. Setting up @MyHunter (Office365) Android Mobile Device: 1. From the Applications menu, select Email. This application may be named Mail

    E-Print Network [OSTI]

    Qiu, Weigang

    Setting up @MyHunter (Office365) ­ Android Mobile Device: 1. From the Applications menu, select Email. This application may be named Mail on some versions of Android. 2. Type your full e-mail address of Android). 4. Enter the following account information and select Next. a. Domain\\Username: Type your full e

  15. Opleidingsonderdeel Docent/assistent Praktisch Locatie Aanvullingen van Chemie Brigou, B. Op 30/06 tussen 10-16u of op afspraak, mail

    E-Print Network [OSTI]

    Einmahl, Uwe

    Opleidingsonderdeel Docent/assistent Praktisch Locatie Aanvullingen van Chemie Brigou, B. Op 30/06 tussen 10-16u of op afspraak, mail naar: bbrigou@vub.ac.be 10G703 Algemene Chemie Brigou, B. Op 30. Enkel op afspraak, mail naar: fcanters@vub.ac.be Chemie: Bouw van de Materie en Chemische Reacties II

  16. U.S. GOVERNMENT PRINTING OFFICE WASHINGTON

    E-Print Network [OSTI]

    Heller, Don

    U.S. GOVERNMENT PRINTING OFFICE WASHINGTON : For sale by the Superintendent of Documents, U­1800 Fax: (202) 512­2250 Mail: Stop SSOP, Washington, DC 20402­0001 90-136 PDF 2004 H.R. 3039

  17. LOTHAR, Department of Energetics ``L. Poggi'', University of Pisa, Italy via Diotisalvi 2, I56126 Pisa, Italy (E-mail lotharing.unipi.it)

    E-Print Network [OSTI]

    Kim, Jungho

    2 252 LOTHAR, Department of Energetics ``L. Poggi'', University of Pisa, Italy via Diotisalvi 2, I­56126 Pisa, Italy (E-mail lotharing.unipi.it) 2 252 J. Jpn. Soc. Microgravity Appl. Vol. 20 No

  18. Protist Genomics * E-mail: pkeeling@mail.ubc.ca

    E-Print Network [OSTI]

    Keeling, Patrick

    , Canada Jean-François Pombert1 , Alexey Smirnov3 , Erick R. James2 , Jan Janouskovec2 , Michael W. Gray4:47 AM #12;Jean-François Pombert et al. Acanthamoeba castellanii Phalansterium cox1 Vermamoeba Physarum cox1 cox2 Phalansterium Acanthamoeba Dictyostelium Polysphondylium Phalansterium Phalansterium

  19. Mail To: University of South Carolina, Office of the University Registrar, Columbia, SC 29208 ***ATTENTION***: This form will not be processed if received by fax, email and/or with credit card information.

    E-Print Network [OSTI]

    . Mail After Degree Posted** - Current Term Only Federal Express Delivery. Required Prepaid Fed Mail After Degree Posted** - Current Term Only Federal Express Delivery. Required Prepaid Fed

  20. Mail Security Hanne Riise Maehlum

    E-Print Network [OSTI]

    in GPG Keychain Access (which comes with GnuGP), while on Windows you have to do this through the command

  1. Sent By Mail: Warren Buffett

    E-Print Network [OSTI]

    Hansen, James E.

    it produces the most global warming pollution per unit of energy. We assume #12;you are familiar and people around the world. We acknowledge that this action is taking place on unceded Coast Salish mile 122 (White Rock pier) on the New Westminster Subdivision, Northwest Division, of the Burlington

  2. Iran. J. Environ. Health. Sci. Eng., 2010, Vol. 7, No. 2, pp. 173-180 *Corresponding author: E-mail: rajch_2001@yahoo.com

    E-Print Network [OSTI]

    Columbia University

    -mail: rajch_2001@yahoo.com Tel: 033-233 46 128, 0943 04 64 865 MUNICIPAL SOLID WASTE MANAGEMENT IN KOHIMA CITY solid waste management is not yet felt in the rural areas of Nagaland. Compared to that. The effective management of municipal solid waste has become a monumental challenge in the town with high

  3. Happy New Year 2003 from SSX-FRC! I just had a look at the e-mail I sent one year ago. We had a very suc-

    E-Print Network [OSTI]

    Brown, Michael R.

    Happy New Year 2003 from SSX-FRC! I just had a look at the e-mail I sent one year ago. We had successfully switched the machine over to SSX-FRC this year. Our scientific focus has switched from local fields on the ends and a poloidal-field-only field reversed configuration or FRC in the middle). We

  4. * Corresponding author. Tel.: 734-647-2505; fax: 734-647-3170. E-mail address: artkuo@umich.edu (A.D. Kuo).

    E-Print Network [OSTI]

    Catherine E. Bauby, Arthur D. Kuo* Department of Mechanical Engineering & Applied Mechanics, University* Corresponding author. Tel.: 734-647-2505; fax: 734-647-3170. E-mail address: artkuo@umich.edu (A.D, and in fact the support leg can do little to alter this motion (Winter, 1991). Townsend (1985) demon- strated

  5. FSU Health Compliance Record fax to 8506448958 or mail to 960 Learning Way, Tallahassee, FL 323064178 Part A--Print or type. Illegible forms will not be processed.

    E-Print Network [OSTI]

    McQuade, D. Tyler

    FSU Health Compliance Record fax to 8506448958 or mail to 960 Learning Way, Tallahassee, FL, at the discre on of health center per sonnel, medical and surgical care including examina ons, treatments to make contact will not prevent emergency treatment if necessary to preserve life or health Signature

  6. Laboratrio de Ixodides, Departamento de Entomologia, Instituto Oswaldo Cruz/FIOCRUZ, Av. Brasil 4365, CEP: 21040-900 Manguinhos, Rio de Janeiro, RJ, Brasil. E-mail

    E-Print Network [OSTI]

    Clayton, Dale H.

    Laboratório de Ixodides, Departamento de Entomologia, Instituto Oswaldo Cruz/FIOCRUZ, Av. Brasil 4365, CEP: 21040-900 Manguinhos, Rio de Janeiro, RJ, Brasil. E-mail: mpvalim@hotmail.com. Recebido em DE ROLINHA [Columbina talpacoti (TEMMINCK, 1810)] NO RIO DE JANEIRO, BRASIL Michel P. Valim, Roger T

  7. Authors' Note: Address correspondence to John Byrne, Center for Energy & Environmental Policy, University of Delaware, Newark, DE 19716-7301; e-mail: jbbyrne@udel.edu.

    E-Print Network [OSTI]

    Delaware, University of

    , University of Delaware, Newark, DE 19716-7301; e-mail: jbbyrne@udel.edu. In an October, 2008 New York Times81 Authors' Note: Address correspondence to John Byrne, Center for Energy & Environmental Policy article, journalist John Tierney argued that recent discus- sions about energy futures ". . . have

  8. Sample Written Request for Information * A requestor submitting an inquiry via electronic mail or facsimile must send the request to a

    E-Print Network [OSTI]

    Dodla, Ramana

    Sample Written Request for Information * A requestor submitting an inquiry via electronic mail or facsimile must send the request to a governmental body's officer for public Information or the person designated by that officer in order to trigger the requirements of the Texas Public Information Act

  9. ISRAEL JOURNAL OF ECOLOGY & EVOLUTION, Vol. 52, 2006, pp. 263279 *Author to whom correspondence should be addressed. E-mail: dbarash@cs.bgu.ac.il

    E-Print Network [OSTI]

    Barash, Danny

    should be addressed. E-mail: dbarash@cs.bgu.ac.il Accepted February 2007. AdAptive MutAtions in Rn rearrangement. We would like to check whether such mutations could be adaptive mutations that may have on both slopes. We expect that further results will shed light on the mutational differences of TPP

  10. Name e-mail position Institution 1 Arndt, Max m.arndt@ged.rwth-aachen.de PhD RWTH-Aachen University, Geologie Endogene Dynamik, Aachen, Germany

    E-Print Network [OSTI]

    Cesare, Bernardo

    Name e-mail position Institution 1 Arndt, Max m.arndt@ged.rwth-aachen.de PhD RWTH-Aachen University, Geologie Endogene Dynamik, Aachen, Germany 2 Billia, Marco marco.billia@alumni.ethz.ch PhD Department of Geology, University of Otago, New Zealand 3 Boutonnet, Emmanuelle emmanuelle.boutonnet@ens-lyon.fr PhD

  11. Using Cross-Evaluation to Evaluate Interactive QA 548 Baldy Hall, University at Buffalo, Buffalo, New York 14260. E-mail: sun3@buffalo.edu

    E-Print Network [OSTI]

    Using Cross-Evaluation to Evaluate Interactive QA Systems Ying Sun 548 Baldy Hall, University at Buffalo, Buffalo, New York 14260. E-mail: sun3@buffalo.edu Paul B. Kantor 4 Huntington St., Rutgers, Scholtz, & Sun 2006; Kelly, Kantor, Morse, Scholtz, & Sun, 2009). We will focus on the X-EVAL method

  12. SUPERVISOR CHECKLIST REGARDING AN INJURED WORKER Contact CEMML HR at CEMML_Contact@mail.colostate.edu or 970-491-6490

    E-Print Network [OSTI]

    regarding work status/restrictions must be provided to CSU Risk Mgmt or CEMML HR timely. Inform employee_Contact@mail.colostate.edu or 970-491-6490 Or CSU Risk Management at k.weigang@colostate.edu or 970-491-4832 INITIALLY FOR ALL, send copy to CSU Risk Mgmt or CEMML HR - http://www.cemml.colostate.edu/employees/assets/pdf/WC%20Guide

  13. Setting up @MyHunter (Office365) -Apple iPhone, iPad, or iPod touch: 1. Tap Settings > Mail, Contacts, Calendars > Add Account.

    E-Print Network [OSTI]

    Qiu, Weigang

    Setting up @MyHunter (Office365) - Apple iPhone, iPad, or iPod touch: 1. Tap Settings > Mail.cuny.edu). 4. Tap Next on the upper-right corner of the screen. Your Apple device will try to find the settings it needs to set up your account. 5. If your Apple device can't find your settings automatically, you

  14. Print http://us.mg4.mail.yahoo.comfneo/launch?.rand=deOsgk04ks40i Subject: Re: [s-w-h] Solar verses wind efficiency

    E-Print Network [OSTI]

    . A single nominal 100 watt solar panel for 4 sun hours/day would yield -4 kWh/day or 12 kWh/month. At $2Print http://us.mg4.mail.yahoo.comfneo/launch?.rand=deOsgk04ks40i Subject: Re: [s-w-h] Solar verses wind efficiency From: David Raine (dave@dyocore.com) To: wind4energy@yahoo.com; Date: Thursday

  15. EcoCore Analytical Services | Dept. 1499, Colorado State University, 200 W. Lake St., Fort Collins CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu

    E-Print Network [OSTI]

    MacDonald, Lee

    CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu Which isotope ratio is being analyzed? Which method were the samples CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel

  16. EcoCore Analytical Services | Dept. 1499, Colorado State University, 200 W. Lake St., Fort Collins CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu

    E-Print Network [OSTI]

    MacDonald, Lee

    CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu Additional sample information: Instrument operation Please select

  17. The effect of superintendent representational style on black and Hispanic student preparation for college 

    E-Print Network [OSTI]

    Doerfler, Carl Brent

    2006-04-12

    that they have equal access to higher education. For example, the SAT and the ACT are repeatedly attacked by minority groups as being racially biased and class biased. Despite efforts by the companies which design and administer the tests to eliminate... codes that will allow them success in the larger society (1995, 28-29). In other words, progressive education reformers are offering minority students a luxury they cannot afford and do not desire. For example, Richard F. Elmore (1996...

  18. ?Muestreme el dinero!: assessing the linkage between Latino school superintendents and English language learner program resources 

    E-Print Network [OSTI]

    Theobald, Nick Andrew

    2009-05-15

    &M University in partial fulfilment of the requirements for the degre of DOCTOR OF PHILOSOPHY Approved by: Chair of Commite, Kenneth J. Meier Commite Members, B. Dan Wood Wiliam F. West Donald R. Dere Head of Department: Patricia A. Hurley... Obispo Chair of Advisory Commite: Dr. Kenneth J. Meier A central question in racial and ethnic politics is whether bureaucratic representation benefits minorities. The theory of bureaucratic representation suggests that pasive representation...

  19. 2013 MUNICIPAL STREETS SEMINAR For public works directors, engineers, street superintendents, maintenance personnel, consultants, city administrators,

    E-Print Network [OSTI]

    concrete pavement that need to be understood. A review of recycled concrete aggregates and their use Costs and Improve Systems Types of Pavement Issues: Why and Prevention Value to City on Recycled-ash and slag will be covered. 9:45 Value to City on Recycled Concrete ­ Mike Danburg, Yaggy Colby Recycling

  20. A Superintendents Guide for Better Understanding CPI and NCES Graduation Rates

    E-Print Network [OSTI]

    Hogan-Newsome, Patricia Marie

    2010-01-01

    14 This 14-digit code is the official, unique identification14 This 14-digit code is the official, unique identificationThis 14-digit code is the official, unique identification of

  1. Understanding Superintendents' Self-Efficacy Influences on Instructional Leadership and Student Achievement 

    E-Print Network [OSTI]

    Whitt, Kenneth Ray

    2011-02-22

    of equitable performance within those subpopulations appeared to be of little significance. It was referenced only at best in passing or within generalized comments regarding the district as a whole! As I reflect on these comments and events, I ask myself ?Why... thinking. Thus, the development of my own epistemological awareness coupled with my own experiences in a school district of low-income homes and children of color, which did not exemplify high equitable success for all students, prompted my personal...

  2. GFNMS Superintendent's Report -Q2FY2015, January ~ March, 2015 Sanctuaries' Expansion Becomes Final

    E-Print Network [OSTI]

    of the most intense and productive upwelling systems in North America, important habitats and subsea features

  3. A case study of the perceptions of current and former school board members of a recently annexed, rural, impoverished, South Texas, Latino school district in a high stakes accountability system 

    E-Print Network [OSTI]

    Rodriguez, Claudia G.

    2009-05-15

    .................................. 27 Rural Superintendent Recruitment .............................................. 31 Superintendent and School Board Relations ............................... 32 The Consolidation Debate... It Closed in 1994 .............................. 59 5. The Superintendent?s House on the Corner.......................................... 60 6. The La Vista ISD Cafeteria .................................................................. 61...

  4. James S. Bogard Mailing Address: Home Work

    E-Print Network [OSTI]

    Pennycook, Steve

    MonitoringSection.Managedpersonnelradiationdosimetry(in-vivo and in-vitro radioassay, internal dose assessment, thermoluminescent dosimetry), radiation standards this period provides a Radiation Standards and Calibration Laboratory addition for low-scatter (neutron LABORATORY, OAK RIDGE, TENNESSEE Dosimetry Applications Research (DOSAR) Program Leader. Responsible

  5. PHYSICS BUILDING TELEPHONE LIST Mail Deliveries

    E-Print Network [OSTI]

    Matter Physics/Materials Science 510C PHENIX/RHIC 510D Engineering/Design/Heavy Ion Research 510E Electronic Detector Group 510F Directors' East 510M RHIC Computing Facility 820M Accelerator Test Facility ...........................x7616 510D Heavy Ion Research Group .......................x1334 510E Electronic Detector

  6. Mailed. Oct. 3, 1935 Science @mice

    E-Print Network [OSTI]

    WHY THE V?EAI?EER 7 ANTARCTIC WIND POWER I By Charles Fitzhugh T d m a n , Authority on Ideteorology directly i n the form of water-power, in which the sun by evaporation has raised water t o a height from which gravity, suitably used, returns power t o US. NOW, although water i s one of the things o f which

  7. Yahoo! My Yahoo! Mail -News Home Hel

    E-Print Network [OSTI]

    promoting nuclear fusion energy and the Aomori prefectural government. On Monday, Japanese government to reach a political resolution by the Group of Eight summit is held in Gleneagles, Scotland, in July in the project -- the United States, Russia, China and South Korea. South Korea and the United States back Japan

  8. Publications Order Form Order by Mail

    E-Print Network [OSTI]

    Brown, Sally

    .S. Pacific Northwest Future Prospects for Western Washington's Timber Supply Forest Fertilization: Sustaining;Shipping Information US Postage: fee is $6.00 per order + $2.00 per book ordered Federal Express: charges vary according to weight and service level. If you wish to have your order shipped using this method

  9. Yahoo! My Yahoo! Mail -News Home Help

    E-Print Network [OSTI]

    by the Group of Eight summit in Gleneagles, Scotland, in July. Yuki said Japan and the European Union have

  10. Mailed April 12, 1934 Sellrice Feature

    E-Print Network [OSTI]

    , reaching far up into the sky and rescilibling saterspouts on the ocean in shape and. general appearance no cutting o r burninc of the skin." Sand penetrated even into underclothing and (All rights reserved

  11. You want to mail or not

    E-Print Network [OSTI]

    Gering, Jon C.

    's contac he position tion for foll SAME DAY et it within ob and enth ut yourself ote. ent to the 1 | P

  12. Dr. Lianfa Song Home (mailing) address

    E-Print Network [OSTI]

    Chen, Xinzhong

    ): Leading-edge Strategies and Technologies for Sustainable Urban Water Management at HKUST, Hong Kong. 2005 and Contracts In US Demonstration of a High Recovery and Energy Efficient RO System for Small-Scale Brackish) Seminal Wind-RO Desalination Demonstration Project (Co-PI, $550,000,2009-2011, funded by Texas Water

  13. Policlinico Umberto I -Dipartimento di Scienze Radiologiche, Oncologiche e Anatomo Patologiche Viale Regina Elena, 324 00161 Roma T (+39) 06 49970270 F (+39) 06 491774 e-mail: vincenzo.tombolini@uniroma1.it

    E-Print Network [OSTI]

    Guidoni, Leonardo

    .tombolini@uniroma1.it Htpp:w3.uniroma1.it/dip-radiologia C.F. 80209930587 P.I. 02133771002 DIPARTIMENTO DI SCIENZE ­ T (+39) 06 49970270 F (+39) 06 491774 ­ e-mail: vincenzo.tombolini@uniroma1.it Htpp:w3.uniroma1.it/dip-radiologia

  14. PHYSICAL ADDRESS: JOSEPH MONTOYA BUILDING, 1100 S ST. FRANCIS DRIVE, ROOM 2073, SANTA FE, NEW MEXICO 87505 MAILING ADDRESS: PO BOX 6850, SANTA FE, NEW MEXICO 87502-6850

    E-Print Network [OSTI]

    New Mexico, University of

    MEXICO 87505 MAILING ADDRESS: PO BOX 6850, SANTA FE, NEW MEXICO 87502-6850 TO: UNIVERSITY OF NEW MEXICO) at UNM Date: January 20, 2010 In 2007, the state of New Mexico enacted the Governmental Dispute to promoting ADR, and other requirements to support the growth and use of ADR. The University of New Mexico

  15. Postal address School of Industrial Design, LTH, P.O. Box 118, 221 00 Lund, SWEDEN Telephone +46 46 222 71 88 E-mail Lynn.Lindegren@kansli.lth.se Website www.industrialdesign.lth.se

    E-Print Network [OSTI]

    Postal address School of Industrial Design, LTH, P.O. Box 118, 221 00 Lund, SWEDEN Telephone +46 46 222 71 88 E-mail Lynn.Lindegren@kansli.lth.se Website www.industrialdesign.lth.se School of Industrial of Industrial Design autumn semester 2015. Full-time study is 30 credits. Bachelor´s programme ­ 1st term Course

  16. A Member of the University of Maine System Tel: 207.581.1561 ~ Fax: 207.581.1213 ~ e-mail: umaineadmissions@maine.edu ~ web: go.umaine.edu

    E-Print Network [OSTI]

    Thomas, Andrew

    A Member of the University of Maine System Tel: 207.581.1561 ~ Fax: 207.581.1213 ~ e-mail: umaineadmissions@maine.edu ~ web: go.umaine.edu Rev. 01.13.15 High School Student Non-Degree Application for any prerequisite (course/grade listed) not taken at the University of Maine or listed on the official

  17. A Member of the University of Maine System Tel: 207.581.1561 ~ Fax: 207.581.1213 ~ e-mail: umaineadmissions@maine.edu ~ web: go.umaine.edu

    E-Print Network [OSTI]

    Thomas, Andrew

    A Member of the University of Maine System Tel: 207.581.1561 ~ Fax: 207.581.1213 ~ e-mail: umaineadmissions@maine.edu ~ web: go.umaine.edu Rev: 01.13.15 HIGH SCHOOL ASPIRATIONS INCENTIVE PROGRAM APPLICATION of Maine. Records Required (sent directly from the high school to the Office of Admission): 1) high school

  18. Request received (from Norway, regarding e-mail titled "Grandparents Oppose Tar Sands"): Thanks. I have seen them in the news here in Norway as well about the Tar Sands.

    E-Print Network [OSTI]

    Hansen, James E.

    Request received (from Norway, regarding e-mail titled "Grandparents Oppose Tar Sands"): Thanks. I have seen them in the news here in Norway as well about the Tar Sands. Question: When you send us by Anne Dalberg, chair of the Sami Church Council. Norway's First Nation - the Sami - showing solidarity

  19. *Correspondence to: Mark S. Fox, Department of Mechanical and Industrial Engineering, and Department of Computer Science, University of Toronto, Toronto, Ontario, Canada M5S 3G9. E-mail: msf@ie.utoronto.ca

    E-Print Network [OSTI]

    Fox, Mark S.

    , and Department of Computer Science, University of Toronto, Toronto, Ontario, Canada M5S 3G9. E-mail: msf and Manufacturing, Ontario Contract/grant sponsor: Digital Equipment of Canada CCC 1094 AND MARK S. FOX* Department of Computer Science, ºniversity of ¹oronto, ¹oronto,Ontario, Canada M5S 3G9

  20. This term sheet is required to be submitted on or before August 15, 2014 via email, fax or USPS mail (postmarked on or before August 15, 2014.) Notification of award of license will be on or

    E-Print Network [OSTI]

    Lawrence, Rick L.

    or USPS mail (postmarked on or before August 15, 2014.) Notification of award of license will be on or before September 15, 2014. MSU reserves the right to not award a license to any respondent and has should be included on separate sheets. Licensed varieties 110WCF57 and/or 111WCF57. A license proposal

  1. EcoCore Analytical Services | Dept. 1499, Colorado State University, 200 W. Lake St., Fort Collins CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu

    E-Print Network [OSTI]

    MacDonald, Lee

    CO, 80523, USA Tel: +1 970-491-5573 | E-mail: Daniel.Reuss@colostate.edu | http://ecocore.nrel.Reuss@colostate.edu | http://ecocore.nrel.colostate.edu TOC analyzer LECO CN analyzer HPLC Freeze-drier PCR RT-PCR Plate

  2. Correspondence and reprint requests: Dr Ping Yu, The Initiative for e-Health, School of Information Technology and Computer Science, The University of Wollongong, Australia. E-mail: ping @uow.edu.au.

    E-Print Network [OSTI]

    Yu, Ping

    of Information Technology and Computer Science, The University of Wollongong, Australia. E-mail: ping @uow.edu.au. © The Journal on Information Technology in Healthcare 2003; 1(5): 369­380 INTRODUCTION The Electronic Health of Information Technology and Computer Science, The University of Wollongong, Australia. ABSTRACT Health

  3. Birnessite formation and its transformation in acid media Xiong Han Feng, fxh73@mail.hzau.edu.cn, Matthew Ginder-Vogel, mattgv@udel.edu, Mengqiang Zhu, mzhu@UDel.Edu, and Donald

    E-Print Network [OSTI]

    Sparks, Donald L.

    Birnessite formation and its transformation in acid media GEOC 47 Xiong Han Feng, fxh73@mail Townsend Hall, 531 South College Avenue, Newark, DE 19716 Birnessite formed in acid media has a similar hexagonal structure to biogenic manganese oxide. The formation of acid birnessite and its transformation

  4. Policlinico Umberto I -Dipartimento di Scienze Radiologiche, Oncologiche e Anatomo Patologiche Viale Regina Elena, 324 00161 Roma T (+39) 06 49970270 F (+39) 06 491774 e-mail: vincenzo.tombolini@uniroma1.it

    E-Print Network [OSTI]

    Di Pillo, Gianni

    .tombolini@uniroma1.it Htpp:w3.uniroma1.it/dip-radiologia C.F. 80209930587 P.I. 02133771002 DIPARTIMENTO DI SCIENZE.uniroma1.it/dip-radiologia C.F. 80209930587 P.I. 02133771002 CONFERISCE Al Dott. Morabito Vincenzo ­ T (+39) 06 49970270 F (+39) 06 491774 ­ e-mail: vincenzo.tombolini@uniroma1.it Htpp:w3.uniroma1.it/dip-radiologia

  5. Print http://us.mg4.mail.yahoo.com/neo/launch?.rand=deOsgk04ks40i Subject: RE: [s-w-h] b Solar verses wind efficiency

    E-Print Network [OSTI]

    .yahoo.com/neo/launch?.rand=deOsgk04ks40i Subject: RE: [s-w-h] b Solar verses wind efficiency From: Michael Klemen (wind4energy;Print http://us.rng4.mail.yahoo.comlneo/launch?.rand=deOsgko4ks4 energy in the wind is proportional://www.ndsu.edu/ndsu/klemen/Perfect_Turbine.htm You can see that for an ideal real life wind turbine ("good turbine") the increase in energy

  6. NIST SP 1029 Structure of a folded catalytic RNA (ribozyme) of the

    E-Print Network [OSTI]

    : NSPUE2 U.S. GOVERNMENT PRINTING OFFICE - WASHINGTON: 2004 For sale by the Superintendent of Documents, U.S. Government Printing Office Internet: bookstore.gpo.gov Phone: 202.512.1800 Fax: 202.512.2250 Mail: Stop Disorder-induced Polaron Formation in Colossal Magnetoresistive Perovskites

  7. e-mail: aamato3@mail.gatech.edu D. Scarborough

    E-Print Network [OSTI]

    Lieuwen, Timothy C.

    Oxycombustion for Low CO2 Cycles: Blowoff Measurements and Analysis Increasing concerns about climate change then be sequestered or used for enhanced oil recovery. Burning fuels in an O2/CO2 diluent raises new combustion trends at high pressure were extrapolated from atmospheric pressure data to simulate conditions closer

  8. e-mail: wzhao10@iit.edu e-mail: kxu8@iit.edu

    E-Print Network [OSTI]

    Qian, Xiaoping

    to be a promising and effective technique to prototype nanoscale devices and nanostructures. AFM can be used to ma , antioxidation mask 4 , single wall carbon nanotube SWCNT based devices 5 , and high density storage 6 . AFM Introduction Nanofabrication and nano-assembly are processes for fabricat- ing devices of dimensions

  9. a Science Service Feature Mailed February 3.9, 1929

    E-Print Network [OSTI]

    3---- Burope*$ recent spell of cold weather is a reminder of the fact that,though glacial periods was at its height, about one-fifth the total land surface of the globe lay buried, only about half has melted that were fed by the melting of the This has been accomplished in several ways; especially,in ice sheet

  10. Vctor Vilarrasa's CV e-mail: vvilarrasa@lbl.gov

    E-Print Network [OSTI]

    Ajo-Franklin, Jonathan

    (UPC), Spain. - Title: Thermo-Hydro-Mechanical Impacts of Carbon Dioxide (CO2) Injection in Deep Saline and particle transport in a rough rock fracture during shear. - Degree completed June 2006. Other courses - 42. and Meier, P., 2013. Thermal coupling may control mechanical stability of geothermal reservoirs during cold

  11. Xiaoping Qian e-mail: xpqian@umich.edu

    E-Print Network [OSTI]

    Qian, Xiaoping

    . Implementation and examples, such as a turbine blade design and prosthesis de- sign, are also presented mechanical fixation with screws or spikes, and filling the space between the prosthesis and bone

  12. Mina de Malfois and the Snail Mail Affair 

    E-Print Network [OSTI]

    2006-07-28

    , Champion finds a disruption of tradi- tionally understood authority, including that of the printed word, and an ongoing debate centered primarily on religion rather than political philosophy. In fact, what he calls ?politico-religious mo- ments...- tion of the republican tradition. For others, Cromwell became a REVIEWS 263 sort of measuring stick around which Robespierre and later Na- poleon would be judged. Both Jane Shaw and Charlotte Sussman discuss another sort of radical politico...

  13. Andrew Kusiak e-mail: andrew-kusiak@uiowa.edu

    E-Print Network [OSTI]

    Kusiak, Andrew

    farms, wind energy cooperatives, wind tur- bines owned by individual investors, and multinational explora- tion of remote sites and offshore locations. Despite the increasing rated capacity of wind-1527 Prediction of Status Patterns of Wind Turbines: A Data-Mining Approach This paper presents the application

  14. Youneng Wang e-mail: yw2119@columbia.edu

    E-Print Network [OSTI]

    Yao, Y. Lawrence

    simulation based on single-crystal plasticity. DOI: 10.1115/1.2714568 1 Introduction The reliability structures in microdevices to improve fatigue and reliability performance. Copper thin films on a single-crystal, shock peened single crystal silicon was experimentally characterized to better understand its effects

  15. Luca Gentili e-mail: l.gentili@unibo.it

    E-Print Network [OSTI]

    Paden, Brad

    materials and systematic optimization of the plant made the new generation of magnetically levitated LVADs in the pump. The HeartQuestTM LVAD incorporates permanent magnet PM bearings that provide four degrees artificial heart: in particular, a magnetically levitated left ventricular assist device is studied

  16. Yahoo! My Yahoo! Mail --Home News Home Hel

    E-Print Network [OSTI]

    fusion an economic source of energy by about 2050. It could be operational by 2016 if building work the plant. The six partners involved in the project are divided in support for competing bids from Japan

  17. Muhammad Faisal Iqbal mfiqbal@mail.utexas.edu

    E-Print Network [OSTI]

    John, Lizy Kurian

    , Electronic Engineering(Honors) May 2003 GIK Institute of Engineering Science and Technology, Pakistan. GPA: 3, Pakistan. Awards & Activities · Fellowship awarded by Higher Education Commision of Pakistan,2007. · Talent Scholarship awarded by Ministry of Science and Technology of Pakistan, 2000. · Scholarship awarded by Ministry

  18. Anas Alfaris e-mail: anas@mit.edu

    E-Print Network [OSTI]

    de Weck, Olivier L.

    , and energy systems have to be designed so that the city has minimum emissions and high efficiency in the use design of all subsystems. Domains such as buildings, transportation, energy, and water are all coupled of the methodology for the design of a new urban development, Masdar City in Abu Dhabi, with over 220 different form

  19. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    U.S. Department of Energy Southwestern Power Administration One West Third Street Tulsa, OK 74103-3502 Headquarters, Operations and Maintenance Offices 918-595-6600 U.S....

  20. T. S. Fisher e-mail: tsfisher@purdue.edu

    E-Print Network [OSTI]

    Walker, D. Greg

    transfer rates that can be exploited in direct thermal-to-electrical energy conversion processes of Mechanical Engineering, Box 1592, Station B, Nashville, TN 37235 Thermal and Electrical Energy Transport emission from nanoscale emitters with particular focus on thermal and electrical energy transport

  1. Jay T. Pukrushpan e-mail: pukrushp@umich.edu

    E-Print Network [OSTI]

    Peng, Huei

    -2125 Control-Oriented Modeling and Analysis for Automotive Fuel Cell Systems Fuel Cells are electrochemical devices that convert the chemical energy of a gaseous fuel directly into electricity. They are widely regarded as a potential future stationary and mobile power source. The response of a fuel cell system

  2. Matthew S. Orosz e-mail: mso@mit.edu

    E-Print Network [OSTI]

    Entekhabi, Dara

    Organic Rankine Cycles The application of organic Rankine cycles (ORCs) for small scale power generation, compactness factor, isentropic efficiency kilowatt-scale organic Rankine cycle Introduction The organic) thermal sources (e.g., geothermal, solar, and industrial). Organic Rankine cycle applications

  3. Special Publication 800-45 Guidelines on Electronic Mail

    E-Print Network [OSTI]

    technical leadership for the Nation's measurement and standards infrastructure. ITL develops tests, test of technical, physical, administrative, and management standards and guidelines for the cost-effective security of the National Institute of Standards and Technology MilesTracy WayneJansen KarenScarfone JasonButterfield #12

  4. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    News, VA 23606 757-269-7100 University of California, Los Angeles Institute for Genomics and Proteomics Box 951570 Los Angeles, CA 90095-1570 310-825-3754 University of...

  5. Andrew Kusiak e-mail: andrew-kusiak@uiowa.edu

    E-Print Network [OSTI]

    Kusiak, Andrew

    of wind power 3 , wind- speed prediction 4,5 , wind farm layout design 6,7 , and turbine monitoring 8 and design of models to control wind turbines. Fadaeinedjad et al. 11 investigated the impact of voltage sag Engineering, 3131 Seamans Center, University of Iowa, Iowa City, IA 52242-1527 Analysis of Wind Turbine

  6. A, Science Service Feature Mailed May 28, 1929

    E-Print Network [OSTI]

    cooled below i t s dew-point. ll&a radio waves neither incroase nor decrease evaporation. !bey put, 1929 7 llMYTHEVEA'MER 7 By Charles Fitzh.u& Talman, Authority on Meteorology RADIO AND WEA'MER-- Radio, but it actually has no effect on weather, though, on the other hand, weather may have some affects on radio

  7. Kostas Vlachos e-mail: kostaswl@central.ntua.gr

    E-Print Network [OSTI]

    Vlachos, Kostas

    . Their system consists of two magnetically levitated and kinemati- cally identical wrists, acting and slave, the proposed environment facilitates functional and simple microrobot control during

  8. umitterb@mail.tuwien.ac.at Schools on Ice

    E-Print Network [OSTI]

    Brückl, Ewald

    is open to further participants from secondary education. 2. Participative GI-based Learning The concept. Introduction Education and outreach are integral to the International Polar Year 2007-08. The project ,,Schools of collaborative learning was originally developed out of the concept of situated learning. This again is closely

  9. e-mail: jiaqil@uci.edu Juntao Xiong

    E-Print Network [OSTI]

    Liu, Feng

    a high tip flare, characteristic of steam turbine blading in low-pressure turbines. The results dem of a Turbine Blade by Using an Adjoint Method This paper presents the application of an adjoint method to the aerodynamic design optimization of a turbine blade. With the adjoint method, the complete gradient informa

  10. Ali Akturk1 e-mail: akturkali@gmail.com

    E-Print Network [OSTI]

    Camci, Cengiz

    the breakdown of the tip leakage vortex in a low speed axial flow compressor. Reducing the tip leakage mass flow rate, in general, improves the aerodynamic performance of axial flow fans and compressors in this study included a 3D Reynolds-averaged Navier­Stokes (RANS) based compu- tational fluid dynamics model

  11. E-Mail karger@karger.com Original Paper

    E-Print Network [OSTI]

    Wade, Juli

    the volume of the ventromedial hypothalamus of gonadectomized ani- mals in the BS, but not the NBS. AR protein in dissections of the hypothalamus and preoptic area was increased in males compared to females hypothalamus · Anolis carolinensis Abstract Sexual behavior in male green anole lizards is regulated

  12. A, @cccco Service Feature Mailed September 7, 1927

    E-Print Network [OSTI]

    time of t h e autumnal equinox. On September 3, 1925, thenaval a i r s h i p "Shenan- doah11 equinox, when the sun crosses the "line" ( i r e , , t h e equator). Of course, i n the long run many

  13. Assistant Professor e-mail: huhui@iastate.edu

    E-Print Network [OSTI]

    Hu, Hui

    . These applications include propellers, sailplanes, ultralight man-carrying/man-powered air- craft, high-altitude,000. In addition to measuring the surface pressure distribution around the airfoil, a high-resolution particle vehicles, wind turbines, unmanned aerial ve- hicles UAVs , and microAir vehicles MAVs . Nondimensional

  14. Extracting Database Information from E-mail Messages

    E-Print Network [OSTI]

    Cooper, R.L.

    Cooper,R.L. Ali,S. 20th British National Conference on Databases, July 2003 pp 271-279 LNCS, Springer

  15. Postdoctoal Fellow e-mail: xiaoboli.liu@utoronto.ca

    E-Print Network [OSTI]

    to maintenance and operation. Civil aviation has enjoyed a quite safe flight records over the years, thanks

  16. E-mail Authorship Verification for Forensic Investigation Farkhund Iqbal

    E-Print Network [OSTI]

    Fung, Benjamin C. M.

    Laboratory CIISE, Concordia University Montreal, Quebec, Canada iqbal_f@ciise.concordia.ca Liaquat A. Khan Computer Security Laboratory CIISE, Concordia University Montreal, Quebec, Canada lakhan@ciise.concordia.ca Benjamin C. M. Fung Computer Security Laboratory CIISE, Concordia University Montreal, Quebec, Canada fung

  17. *Corresponding author. E-mail address: pinsky@uh.edu

    E-Print Network [OSTI]

    Dutz, Hartmut

    22901, USA. Now at Texas Tech Univ., Lubbock, TX 79409-1031, USA. Now at CIEMAT, Avda Complutense 22

  18. Pricing Electronic Mail to Solve the Problem of Spam

    E-Print Network [OSTI]

    to generate, store, and transmit information can lead to a "poverty of attention" (Simon, 1982). 196 KRAUT and the poverty of at- tention

  19. A-Science Service Feature Mailed April 30, 1931

    E-Print Network [OSTI]

    their natural hei&t, with inverted images of various fsatures i n the sky. every sail and spar d i s t i n c

  20. Pezhman Akbari e-mail: akbari@iupui.edu

    E-Print Network [OSTI]

    Müller, Norbert

    applications. Shock tubes, shock tunnels, pulse combustors, pulse detonation engines, and wave rotors are a few recent efforts: utilization of such devices in pressure-gain combustors, ultra-micro gas turbines

  1. Yahoo! My Yahoo! Mail Sign Up -News Home Help

    E-Print Network [OSTI]

    Moscow's backing in the contest to build the first reactor to generate nuclear energy in the same way under which the reactor would be built at Cadarache while the computer center to control, 2004 Search Search Advanced Japanese minister draws blank in Moscow talks on nuclear fusion plant Thu

  2. E. Velikhov e-mail: velikhov@mac.com

    E-Print Network [OSTI]

    type of fission reactors, including hybrid devices as "green" nuclear energy energy consumpAon scenarios in the world in the XXI century. According Energy Demands and Supply Opportuni=es of Energy Sources Balance of Primary Energy

  3. Yahoo! My Yahoo! Mail Sign Up -News Home Help

    E-Print Network [OSTI]

    and Washington. news web sites Chirac gave the undertaking during talks with Chinese President Hu Jintao in Paris a visit to Washington last month by Chinese Premier Wen Jiabao. news web sites Relations between France Iraq ( - )news web sites AFP Photo Welcome, Guest Yahoo! News Thu, Jan 29, 2004 US rebuffs Chirac

  4. Ryan Fellini e-mail: rfellini@umich.edu

    E-Print Network [OSTI]

    Papalambros, Panos

    , University of Michigan, G.G. Brown Building, Ann Arbor, Michigan 48109 Platform Selection Under Performance performance. A family of automotive body side frames is used to demonstrate the approach. DOI: 10.1115/1.1899176 1 Introduction A product platform is defined as the set of components and manufacturing and assembly

  5. Mail & Package/Receiving Clerk | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    impacts. Complies with ES&H Directives, DOE Orders and OSHA standards. Reports all ES&H problems, violations or concerns to appropriate individual. *Perform equipment and...

  6. R. A. Wirtz e-mail: rawirtz@unr.edu

    E-Print Network [OSTI]

    Wirtz, Richard A.

    are investigated. Inte- gration of a design optimization algorithm into a thermal performance model of the TES-hybrid heat sink results in determination of a best design subject to geometric and heat loading constraints

  7. Mailing Addresses and Information Numbers for Operations, Field...

    Energy Savers [EERE]

    900 Commerce Road East New Orleans, LA 70123 504-734-4200 U.S. Department of Energy West Valley Demonstration Project 10282 Rock Springs Road West Valley, NY 14171-9499...

  8. e-mail: ymli@umac.mo Qingsong Xu

    E-Print Network [OSTI]

    Li, Yangmin

    , Macao SAR, China Kinematic Analysis and Design of a New 3-DOF Translational Parallel Manipulator A new. The inverse kinematics, forward kinematics, and velocity analysis are performed and the singular and isotropic.1115/1.2198254 Keywords: parallel manipulators, mechanism design, kinematics, singularity, isotropy, workspace, dexterity

  9. Andreas A. Malikopoulos e-mail: amaliko@umich.edu

    E-Print Network [OSTI]

    Papalambros, Panos

    , which learns the values of injection timing and variable geometry turbocharging vane position, variable geometry turbocharging VGT , exhaust gas recirculation EGR , and variable valve actuation VVA

  10. Soumik Sarkar e-mail: szs200@psu.edu

    E-Print Network [OSTI]

    Ray, Asok

    are used for fault detection in aircraft gas turbine engines. The proposed methodology of data-driven fault.1115/1.4002877 Keywords: aircraft gas turbine engines, data-driven fault detection, optimal feature extraction, multiclass classification 1 Introduction Health monitoring of human-engineered complex systems e.g., aircraft gas turbine

  11. Dongmei Chen e-mail: hpeng@umich.edu

    E-Print Network [OSTI]

    Peng, Huei

    the humidifier operation. DOI: 10.1115/1.1978910 1 Introduction The polymer electrolyte membrane PEM fuel cell as flooding will occur. Flooding causes the blockage of the gas flow channels, electrodes, and backing layers to control the membrane humidity of the fuel cells to avoid dehydration and flooding. Maintaining proper

  12. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Interactions.org Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  13. Competition and price discrimination in the market for mailing lists

    E-Print Network [OSTI]

    Borzekowski, Ron; Thomadsen, Raphael; Taragin, Charles

    2009-01-01

    Katz, M. L. (1984). Price discrimination and monopolistic395–416. Shepard, A. (1991). Price discrimination and retailJ. (1952). The theory of price. New York: Macmillan. Stole,

  14. E-Mail This Article Printer-Friendly Version

    E-Print Network [OSTI]

    - d(current density of 188 ± 10 A/m3) at an applied voltage 0.6 V. The energy efficiency relative UNIVERSITY PARK, PA - Making hydrogen by microbial electrolysis has come a long way in recent years. In a microbial electrolysis cell (MEC), bacteria break up fermented plant waste to form hydrogen. A couple

  15. Scott G. Olsen e-mail: olsensg@gmail.com

    E-Print Network [OSTI]

    Bone, Gary

    robots that interact forcibly with their envi- ronment, such as robotic excavation machinery for simulation and design of robotic bulldozing control strategies. [DOI: 10.1115/1.4023061] 1 Introduction 1 of robotic mobile machinery to improve productivity, efficiency, and safety. Modeling of the interaction

  16. 2/1/2014 Mobiles phones powered byWIND TURBINES: 'Micro-windmills' could be fitted to phones | Mail Online http://www.dailymail.co.uk/sciencetech/article-2538700/The-wind-turbines-MOBILES-Micro-windmills-smaller-grain-rice-one-day-fit-inside-charge-phones

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    2/1/2014 Mobiles phones powered byWIND TURBINES: 'Micro-windmills' could be fitted to phones | Mail Online http://www.dailymail.co.uk/sciencetech/article-2538700/The-wind-turbines-MOBILES-Micro-windmills-smaller-grain-rice-one-day-fit-inside-charge-phones.html 1/5 The mobiles powered by WIND TURBINES: 'Micro-windmills

  17. Housing and Residence Life 1977 SW 6th Ave Suite 210 Portland, OR, 97201 Phone: (503) 725-4375 Fax: (503) 725-4394 E-mail: Housing@pdx.edu www.pdx.edu/Housing PORTLAND STATE UNIVERSITY HOUSING PROPOSED CONTRACT TERMS & CONDITIONS

    E-Print Network [OSTI]

    Elzanowski, Marek

    Housing and Residence Life 1977 SW 6th Ave Suite 210 Portland, OR, 97201 Phone: (503) 725-4375 Fax: (503) 725-4394 E-mail: Housing@pdx.edu www.pdx.edu/Housing 2015-2016 PORTLAND STATE UNIVERSITY HOUSING PROPOSED CONTRACT TERMS & CONDITIONS 1) Term of Contract: This Contract is binding upon signature

  18. Solar Installation Contractor

    Broader source: Energy.gov [DOE]

    Alternate Title(s):General Contractor, Electrical or Plumbing Contractor, Construction Manager, Project Superintendant

  19. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail: zhien@agnes.gsfc.nasa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect PhotovoltaicsStructure andChallenge | Department,Aerosol

  20. Studying Altocumulus Plus Virga with Ground-based Active and Passive Remote Sensors Zhien Wang1, Kenneth Sassen2, David Whiteman3, and Belay Demoz3 1University of Maryland, Baltimore County, Catonsville, MD 21228 2University of Alaska, Fairbanks, Alaska 99775 3NASA Goddard Space Flight Center, Greenbelt, MD 20771 E-mail: zhien@agnes.gsfc.nasa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Homesum_a_epg0_fpd_mmcf_m.xls" ,"Available from WebQuantityBonneville Power AdministrationRobust,Field-effect PhotovoltaicsStructure andChallenge | Department,AerosolSeasonal and

  1. New York City School Evaluations: Comparing Parent, Teacher, and Government Assessments 

    E-Print Network [OSTI]

    Favero, Nathan 1991-

    2012-04-20

    - quently explored. One reason may be the classic view that individuals within the system are career bureaucrats.3 Still, leadership stability has been a concern; a point of persistent tension between U.S. politicos and career appointees is the relative..., is included in the analysis. THE UNITS OF ANALYSIS Our data are drawn from a set of Texas school districts. We sent a mail questionnaire on management styles, goals, and time allocations to district superintendents. (The return rate was 55 percent with 507...

  2. Insects of the Garden, With a Chapter on the Melon Louse and Other Aphids. 

    E-Print Network [OSTI]

    Conradi, Albert F. (Albert Frederick); Sanborn, C. E.

    1906-01-01

    Cle MISS M. H. WATKINS ........................................ 1 . Stenograp? tor :or rol ~t-k ,A ier STATE SUB-STATIONS S. A. WASCHKA, superintendent ........... .................. Trou p Smith County W. S. HOTCHKISS, Superintendent... .......... ........ ... ............................................................................................................ 18 Squash .............................................................................................................................. .......................... 18 Onion...

  3. General Construction Company Private Development Procedure

    E-Print Network [OSTI]

    Eason, Scott W.

    2006-05-19

    superintendent is handed the project • Personnel placement: a network of field personnel within the grading, bridge and paving divisions are chosen by the superintendent, as well as, subcontractors are utilized • Working to completion: successfully constructing...

  4. Administrator's Perceptions on Growing Populations of Students who are English Language Learners in the State of Wyoming 

    E-Print Network [OSTI]

    Shannon, Keri Leigh

    2014-01-31

    superintendents face in their roles, and the ways that effective superintendents transform schools and student outcomes. Especially important in the literature are the discussions of how culturally responsive leadership is imperative for students to succeed...

  5. The Politics of Public Management: Exploring the Importance of Environmental Support 

    E-Print Network [OSTI]

    Melton, Erin Kelly

    2012-07-16

    Effect of Support on Attendance Rates as Prospector Strategy Changes ................................................................. 56 4.1 Environmental Support in Districts with Minority Superintendents... ........................................................................... 120 4.2 Environmental Support in Districts with Non-Minority Superintendents ................................................................... 121 xiii LIST OF TABLES TABLE...

  6. NotciasNotcias EntretenimentoEntretenimento EsportesEsportes VdeosVdeos Rede RecordRede Record E-mailE-mail Estado Contedo

    E-Print Network [OSTI]

    Barbosa, Marcia C. B.

    desde como ocorrem terremotos ao surgimento de uma doença autoimune. "Anomalia é tudo o que não é comum

  7. *e-mail: {m-niwa, noma, hosaka}@atr.jp **e-mail: yanagida@ccmfs.meijo-u.ac.jp

    E-Print Network [OSTI]

    Lindeman, Robert W.

    correct, stable stimulation. However, the mechanical stability of the vibration is affected by many that produce the vibration, are run with only a binary state, ON or OFF [1], because the mechanical stability the electrical and mechanical conditions of the vibrator: how the vibrators are mounted. These factors affect

  8. POLYCYCLIC AROMATIC HYDROCARBONS AS A TRACER OF STAR FORMATION? NASA Ames Research Center, Mail Stop 245-6, Moffett Field, CA 94035; epeeters@mail.arc.nasa.gov

    E-Print Network [OSTI]

    Spoon, Henrik

    POLYCYCLIC AROMATIC HYDROCARBONS AS A TRACER OF STAR FORMATION? E. Peeters NASA Ames Research) pumped large polycyclic aromatic hydrocarbon (PAH) molecules. As such, these features trace the FUV of polycyclic aromatic hydrocarbons (PAHs) containing '50 carbon atoms (Le´ger & Puget 1984; Allamandola et al

  9. Noah D. Manring e-mail: ManringN@missouri.edu

    E-Print Network [OSTI]

    Manring, Noah D.

    - chanical power into hydraulic power. This energy conversion pro- cess is achieved at an efficiency level it is reported. DOI: 10.1115/1.1926311 Introduction Background Hydraulic pumps are used to convert rotating me that can often be low; and, therefore, pump efficiency data always accompanies the sale of hydraulic pumps

  10. S. L. Mitchell1 e-mail: sarah@iam.ubc.ca

    E-Print Network [OSTI]

    Peirce, Anthony

    of Hydraulic Fractures: The Impermeable Case This paper presents a novel asymptotic framework to obtain detailed solutions describing the propagation of hydraulic fractures in an elastic material. The problem physical processes of viscous dissipation and structure energy release compete. DOI: 10.1115/1.2200653 1

  11. CIOSS Fellows' Areas of Expertise Name Research Interests E-mail Phone Number Website

    E-Print Network [OSTI]

    Kurapov, Alexander

    Oceanography Jack Barth Frontal instability processes; coastal ocean dynamics; eastern boundary currents and dynamic methods; prediction of transient currents in the mid-latitude ocean; interannual variation://www.coas.oregonstate.edu/faculty/barth.html Dudley Chelton Mesoscale oceanic eddies; large-scale, low-frequency variability of ocean circulation

  12. Journal of Medical Entomology Copy of e-mail Notification me2044

    E-Print Network [OSTI]

    Solé-Cava, Antonio M.

    sentences or errors in tables. * Mark clearly legible corrections in red directly on the page proof of the proofs and listed on the last page of the proofs; and * Verify that tables, figures, and figure captions in the price of the reprints. Orders shipped outsi

  13. e-mail: dr.mohsen.akbari@gmail.com Biomedical Engineering Department,

    E-Print Network [OSTI]

    Bahrami, Majid

    in use for liquid handling in microfluidic systems, such as the use of pumps, centrifugal force, electro

  14. Effect of Media Usage Selection on Social Mobilization Speed: Facebook vs E-Mail

    E-Print Network [OSTI]

    Wang, Jing

    Social mobilization is a process that enlists a large number of people to achieve a goal within a limited time, especially through the use of social media. There is increasing interest in understanding the factors that ...

  15. Abel Siu-Ho e-mail: qu@hawaii.edu

    E-Print Network [OSTI]

    Qu, Weilin

    -fin heat sink were investigated experimentally. Fabricated from 110 copper, the heat sink con- tained. As a result, there is an increasing demand for highly efficient electronic cooling technologies

  16. he e-mails leaked from the University of East Anglia's Climatic Research Unit

    E-Print Network [OSTI]

    Nizkorodov, Sergey

    Earth's climate system and its com- ponents, and yes, nothing has been made clear enough to the public used to simulate Earth's climate are general circulation models (GCMs), which represent physical changes and the inability of climate models to simulate such warming without including the role

  17. : +30 210 772 3205 E-mail: kekos@chemeng.ntua.gr

    E-Print Network [OSTI]

    Papanicolaou, Vassilis

    ) : 5.1: (Protocol for bioethanol production from the liquid fraction derived from pretreatment of lignocellulosic biomass) 5.2: #12; 9464-6 2 (Protocol for bioethanol.3: (Protocol for bioethanol production from the saccharified solid residue derived from pretreatment) 5

  18. Internet: http://ue.eu.int/Newsroom E-mail: press.office@consilium.eu.int

    E-Print Network [OSTI]

    ), establishing a European Chemicals Agency and amending Directive 1999/45/EC and Regulation (EC) (on Persistent Organic Pollutants) = Proposal for a Directive of the European Parliament and of the Council amending Council Directive 67/548/EEC in order to adapt it to Regulation (EC) of the European Parliament

  19. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Kajiura, Stephen

    in the connective tissue or between adjacent muscles [Wueringer and Tibbetts, 2008], the re- ceptor array is 3 combined with the low densities around the mouth could indicate that sawfish use their rostrum to stun

  20. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Robinson, Gene E.

    for drone and queen honey bees and other insect species that do not exhibit dance communication. We suggest

  1. Amir A. Kharazi e-mail: kharazia@egr.msu.edu

    E-Print Network [OSTI]

    Müller, Norbert

    .1115/1.1850503 Introduction The potential for using wave devices in thermodynamic cycles for power generation, propulsion- strated an attractive potential for reaching the ultrahigh perfor- mance targets of power systems-Port Condensing Wave Rotor Using a novel 3-port condensing wave rotor enhancing the turbocompression in a R718

  2. Student last name First Middle UA ID number Local mailing address

    E-Print Network [OSTI]

    Hartman, Chris

    to control weight Condition Yes Year Anorexia nervosa Binge eating/Purging (bulimia) Ulcer (duodenal

  3. LAST NAME: FIRST NAME: M.I.: MAILING ADDRESS: CITY: STATE: ZIP

    E-Print Network [OSTI]

    Russell, Lynn

    AND ISI S INFORMATION ORIGINAL ISIS TRANSACTION NUMBER: ______________ AMOUNT CREDITED TO ISIS: $______________ NEW ISIS TRANSACTION NUMBER: ______________ REFUND DUE CUSTOMER: $______________ DATE PROCESSED IN ISIS: Distribution: White-Accounting Yellow-Customer CREDIT STUDENT (ISIS) ACCOUNT REFUND (CHECK

  4. Laura F. Serpa Dept. of Geological Sciences e-mail: lfserpa@utep.edu

    E-Print Network [OSTI]

    Lesser, Larry

    , Salt Lake City, UT. B.S. (1977) Geophysics, University of Utah. (Magna Cum Laude) EXPERIENCE 8 (2002-6) NSF Course, Curriculum, and Laboratory Improvement (August, 1999, 2001, 2004) NSF Tectonics Division Review Panel (1993-1996) NSF Tectonics and Petrology Division Program Oversight committee (1991

  5. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Fernández-Juricic, Esteban

    the wholemount tech- nique and numerous methods for visualizing ganglion Key Words Vision Ganglion cell Photoreceptor Oil droplet Visual acuity Neuroethology Topography Behavioural ecology Abstract The accessibility of the vertebrate retina has provided the opportunity to assess various parameters of the visual abili- ties

  6. A. Lacarelle1 e-mail: arnaud.lacarelle@tu-berlin.de

    E-Print Network [OSTI]

    Noack, Bernd R.

    the effects of thermoacoustic instabilities on the flow field at the burner inlet and outlet. The actuation. The mechanisms leading to thermoacoustic instabili- ties are numerous and closely related to each other: fuel

  7. Undergraduate Advisor List Lastname Firstname College/School Program Building Phone E-mail

    E-Print Network [OSTI]

    Pittendrigh, Barry

    , Wildlife, Natural Resources Planning and Decision Making, Wood Products Manufacturing Technology PFEN 494 Control SMTH 494-4564 gbennett@purdue.edu Buckmaster Dennis Agriculture Agricultural Systems Management Management KRAN 494-9041 cdobbins@purdue.edu Engel Bernard Agriculture Pre Agricultural and Biological

  8. * Corresponding author. E-mail address: jbru@u.washington.edu (L.B. Brubaker).

    E-Print Network [OSTI]

    Hu, Feng Sheng

    B. Brubaker *, Patricia M. Anderson , Feng Sheng Hu College of Forest Resources, University discon- tinuous peat sections from the Yukon-Kuskokwim Delta and Bristol Bay region (Ager, 1982; Hu et al

  9. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Environmental Management (EM)

    todesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Better Buildings: Financing and Incentives: Spotlight on Maine: Transition to a Sustainable Level of Incentives...

  10. AREA: FISICA, CHIMICA E MATEMATICA NOMINATIVO indirizzo mail CORSI DI DOTTORATO DI RICERCA AFFERENTI

    E-Print Network [OSTI]

    STRUTTURALE, SISMICA e GEOTECNICA ARCHITETTURA, INGEGNERIA DELLE COSTRUZIONI e AMBIENTE COSTRUITO AREA

  11. * Corresponding author. E-mail address: ebert@cwi.nl (U. Ebert).

    E-Print Network [OSTI]

    Ebert, Ute

    like a front, vortex or pulse to external forces and noise can generally be derived if two conditions plumes [21,22], in chemical wave dynamics [23], combustion fronts [3], etc. The main physical idea, like vortices, or pulse-type solutions like sources, sinks, solitons, etcetera [24}28]. The response

  12. Hyung Jun Koo E-mail: hjkoo@ncsu.edu Tel: 919-434-3676

    E-Print Network [OSTI]

    Velev, Orlin D.

    : Effect of cell geometry on photovoltaic parameters", Solar Energy Materials and Solar Cells, 91, 1749 spherical TiO2 as bi-functional material for high efficiency dye-sensitized solar cells", Advanced Materials Researcher (2006. 3 ~ 2007. 5 ) Korea Institute of Science and Technology (KIST) Theme: Fabrication of high

  13. Artin Der Minassians1 e-mail: artin.der.minassians@gmail.com

    E-Print Network [OSTI]

    Sanders, Seth

    of California, Berkeley, Berkeley, CA 94720 Stirling Engines for Distributed Low-Cost Solar concentrators, integrated with free-piston Stirling engine devices incorporating integrated electric generation-piston Stirling engine prototype. A very low loss resonant displacer piston is designed for the system using

  14. Artin Der Minassians1 e-mail: artin.der.minassians@gmail.com

    E-Print Network [OSTI]

    Sanders, Seth

    of California, Berkeley, 518 Cory Hall, Berkeley, CA 94720 Multiphase Stirling Engines Analysis, design, fabrication, and experimental assessment of a symmetric three-phase free-piston Stirling engine system dissipation phenomenon for low-power Stirling engines and should be carefully addressed in design. Analysis

  15. ? "Y SILF: WE,ASIiER ? Mailed Mov. 15, 1934 A Science Service Feature

    E-Print Network [OSTI]

    , Of the t o t a l power of the engine. The loss of power, says the Bureau, i s p r o p o r t i o n d ltAlthough,ttwe are told, Itby proyer adjustment of the carburetor equally efficient -operation can b e obtained irres9

  16. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    for multiple days in a row including digging soil pits/auger deep soil wells, and lifting and carrying soil profiles; 2) Develop and implement well-controlled laboratory and modeling experiments

  17. Date: _____________ Page ______ of ______ (if known) Name / Organization Mailing Address / Organization Contact Person

    E-Print Network [OSTI]

    Karsai, Istvan

    : ____________________________________________ City/St/Zip: ____________________________________________ Deposit Transmittal for ETSU Foundation Funds I certify that these funds should be deposited in the ETSU Foundation account listed: ___________________________ Fax: _______________ East Tennessee State University--Advancement Services ETSU Advancement Services

  18. PURPOSE/USE OF DATA Solicitation Visit Mailings Donor History Other (specify): __________________________________________________________

    E-Print Network [OSTI]

    Karsai, Istvan

    ): __________________________________________________________ ______________________________________________________________________________________________________________________ ______________________________________________________________________________________________________________________ How will this data/output be utilized? Internal (Inside ETSU) External (Outside ETSU) If external that the information will be kept private, used for ETSU official business only and will not be provided to unauthorized third-parties. ETSU Advancement Services Campus Box 70721 423-439-4242 renfroe@etsu.edu Date

  19. e-mail: rahman@engineering.uiowa.edu Department of Mechanical & Industrial

    E-Print Network [OSTI]

    Rahman, Sharif

    subject to cyclic thermal loading. It involves a global deformation analysis, a local critical solder analysis, the total fatigue life predicted using the energy-based method is larger than 2500 cycles revalida- tion when changes occur in the design or manufacturing pro- cesses. In addition, currently

  20. *Corresponding author. E-mail address: #ame@zen.phys.columbia.edu (J. Hong).

    E-Print Network [OSTI]

    Science B.V. All rights reserved. PII: S 0 1 6 8 - 9 0 0 2 ( 0 0 ) 0 0 4 2 8 - 9 #12;Radiological Research Accelerator Facility at Nevis Labor- atories, Columbia University, P.O. Box 21, Irvington, NY 10533, USA

  1. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA)

    York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov...

  2. 19 10 1 (2003. 5) e-mail : {sniper, yang}@cs.yonsei.ac.kr

    E-Print Network [OSTI]

    Yang, Sung-Bong

    ] . , . , , . . , . . . . MAUT (Multi-Attribute Utility Theoretic negotiation for electronic commerce) [1] . (Pareto solution)[4] 3 . #12; 19 10 1 (2003. 5) 2 MAUT [1] . . f

  3. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Nizet, Victor

    , Faculty of Pharmacy, Cairo University, Cairo, Egypt; e VA Medical Center and f Molecular Resource Center M types is proposed. The vast majority of GAS infection is benign. Nonetheless, many divergent M types possess limited capacity to cause invasive infection. M1T1 GAS readily switch to a covRS mutant

  4. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones

    2012-12-01

    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  5. A small napkin Globe and Mail, Facts and Arguments, Thurs. Feb 6. 1997.

    E-Print Network [OSTI]

    Taylor, Peter

    this morning and flopped down in the chair. She was wearing a racy black fedora, but her mouth was grim. Exam

  6. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    of the hypothalamus. EB did not alter SRC-2 expression in any of the three brain re- gions analyzed. Conclusions Hypothalamus Progestin receptor Sexual behavior Steroid receptor coactivator Steroid receptor coactivator-1%), ventromedial nucleus of the hypothalamus (63%) and arcuate nucleus (76%) coexpressed both SRC-1 and SRC-2

  7. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Ryan, Michael J.

    , anterior hypothalamus, ventromedial hypothalamus, and ventral tegmental area/substantia nigra pars compacta

  8. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Wade, Juli

    ], and the ventromedial hypothalamus (VMH), which controls female behaviors such as procep- tive and receptive behaviors Androgen metabolism Preoptic area Testosterone Ventromedial hypothalamus Abstract The 5 -reductase (5 R), and ventromedial hypothalamus (VMH). More 5 R2 cells were detected during the NBS than BS in the AMY

  9. Publications Mail agreeMent nuMber 40683196 return undeliverable canadian addresses to

    E-Print Network [OSTI]

    Saskatchewan, University of

    canadian addresses to: college of engineering, university of saskatchewan, dean's office, 57 caMPus drive College of Engineering. Use of the University of Saskatchewan logo is regulated by the University logo is property of the University of Saskatchewan College of Engineering. Reproduction of this logo

  10. A. S. Alsuwaiyan1 e-mail: suwaiyana@yahoo.com

    E-Print Network [OSTI]

    Shaw, Steven W.

    and Dowell 3 investigated localization phenomenon in a chain of coupled oscil- lators, and Pierre et al. 4

  11. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    Gabriella March Apr. 17 Michael Mann Penn State Univ. A&O (April 17, Robock) Apr. 25 Possible BOV meeting

  12. Biographical Sketch: N. A. W. Holzwarth Mail: Wake Forest University, Department of

    E-Print Network [OSTI]

    Holzwarth, Natalie

    , City College of New York 1980-1982: Research Physicist, Theoretical Sciences Group, Exxon Research. Nicholas Lepley, Yaojun A. Du, and N. A. W. Holzwarth, "Structures, Li+ mobilities, and interfacial

  13. Hongliang Wang1 e-mail: hw2288@columbia.edu

    E-Print Network [OSTI]

    Yao, Y. Lawrence

    , by adopting large area deposition capa- bility, and the use of cheap and flexible substrates. Typical thin film solar cells used in terrestrial PV (photovoltaic) applications consist of back contact, absorber

  14. EDITORS: Corrected C?opy, please su'bstttute f o r that mailed you yesterday.

    E-Print Network [OSTI]

    for the following: 0 summer fog f o r fair, A winter fog f o r rain; A fact most everywhere, In valley and on plain. When fog goes up the rain is oror; When fog comes down ' t w i l l rain som more. When the is dry me r

  15. Public release date: 20-Feb-2007 [ Print Article | E-mail Article | Close Window

    E-Print Network [OSTI]

    Gosselin, Frédéric

    , it would take them a bit longer to recognize the image as a battery," Gibson says. The researchers employed identify a AA battery from the side profile. But, let's say the person could see the same battery only from; from the bottom, the corners of the battery now are not visible and information about the corners

  16. chenyc@ismp.csie.ncku.edu.tw jchiang@mail.ncku.edu.tw

    E-Print Network [OSTI]

    ) (divide-and-conquer principle) (feature selection) (Reuters-21578) 1. (text categorization) (assign) #12;4. 4.1 David D. Lewis [1996] Reuters-21578 21578 (EXCHANGES, ORGS, PEOPLE, PLACES Conference on Machine Learning, 1997, pages 170-178. #12;Lewis, D. D., Reuters-21578 Text Categorization Test

  17. e-mail: shenlu2@illinois.edu Nathan B. Schroeder

    E-Print Network [OSTI]

    Kim, Harrison

    to the recurring costs accompanying diesel generation, the quantification of the environmental impact due study of a stand-alone hybrid photovoltaic/wind power generation system is presented to demonstrate/Energy Generation Through Multidisciplinary and Multilevel Design Optimization With Complementarity Constraints

  18. Xi-Min Deng (Ph.D.) Current mailing address406 9th

    E-Print Network [OSTI]

    Liu, Gang-yu

    (growth and yield responses of strawberry to elevated CO2 and N supply) 2011 ­ 2014 Chinese ProfessorFI Woodward. The growth and yield responses of strawberry to elevated CO2 and N supply. Ann. Bot. 199881: 67

  19. (Pinus heldreichii Christ) "" e-mail : panayotov.m@ltu.bg

    E-Print Network [OSTI]

    University of Forestry (Bulgaria)

    .30 0.00 0.0255 0.23 0.33 8.47 1.20 1900 0.22 0.00 0.0340 0.17 0.27 15.16 2.14 , mm 2100 0.34 0.01 0.0555

  20. s61553@mail.ecc.u-tokyo.ac.jp FPGA(Field Programmable Gate Array)

    E-Print Network [OSTI]

    Aihara, Hiroaki

    ) FPGA MathWorks MATLAB 2 FIR(Finite Impulse Response) x(tn) y(tn) y(tn) = N-1 k=0 akx(tn-k) (1) N s x ( t - 2n s )] × k ak exp ( i 2 s k ) (2) ak Fourier MATLAB 1 #12;3 1 1 AMPADC DAC FPGA Xilink Spartan3e × Vin - 1.65(V) 1.25(V) × 8192 (3) MATLAB 5 10kHz 5 N = 101 DAC(LTC2624) DAC Vout = D[11 : 0] 4096 × (3

  1. E-mail: broberts@bard.edu Manuscript received 23 August 2011; accepted 30 April 2012.

    E-Print Network [OSTI]

    Landis, Doug

    dedicados a biocombustibles (agrocombustibles) aumentará las demandas en las tierras de cultivo existentes

  2. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    in the neighborhood 02 Bottled Gas (LPG or Propane) 03 Fuel Oil 04 Kerosene or Coal Oil 05 Electricity 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel...

  3. A Response to Paul Gronke's blog, "Measuring Turnout Effects of Vote by Mail in California"

    E-Print Network [OSTI]

    DiCamillo, Mark J.

    2009-01-01

    A Response to Paul Gronke’s blog, “Measuring Turnout Effectson the Election Updates blog, of which he is a collaboratorA Response to Paul Gronke's blog, "Measuring Turnout Effects

  4. Jeremy J. Michalek1 e-mail: michalek@umich.edu

    E-Print Network [OSTI]

    Papalambros, Panos

    , accounting for up to 95% of city CO emissions, 32% of NOx emissions, and 25% of volatile organic compound A Study of Fuel Efficiency and Emission Policy Impact on Optimal Vehicle Design Decisions Recent efficiency and emission policies on the long-term design decisions of profit-seeking automobile produc- ers

  5. Mary Lou Fulton Teachers College Mailing Address: PO Box 37100, Phoenix, AZ 85069-7100

    E-Print Network [OSTI]

    -6350 Technology Infusion Specialist, #10708 The Mary Lou Fulton Teachers College invites applications for one full time Technology Infusion Specialist position. Duties and Responsibilities include: Under the direction of the technology infusion coordinator, the technology infusion specialist will work with MLFTC staff and faculty

  6. E-mail dated April 27, 2010 from President Scoggins Dear Colleagues

    E-Print Network [OSTI]

    the infusion of federal funds from the American Reinvestment and Recovery Act (ARRA). With very little ARRA

  7. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    · Visiting Research Specialist -Illinois State Geological Survey -Prairie Research Institute -University

  8. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    Geochemist -Illinois State Geological Survey -Prairie Research Institute -University of Illinois at Urbana

  9. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    to Appoint Lamont Research Professors · Visiting Environmental Assessments Specialist -Illinois State Geological Survey - Prairie Research Institute -University of Illinois at Urbana-Champaign JOB OPENINGS: UCLA

  10. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    for a one- year visiting professor position · Visiting Research Specialist -Illinois State Geological Survey

  11. E-Mail This Article Print This Article Share This Related Articles Noah Finkelstein

    E-Print Network [OSTI]

    Finkelstein, Noah

    , notes Dawn Del Carlo, a chemistry professor at the University of Northern Iowa in Cedar Falls, who Building your network Salary Tools Find out how much you're worth with our salary calculator Jobs Funding are weak in chemistry," says Diane Bunce, a chemistry professor at Catholic University of America

  12. High Assurance Multilevel Secure Mail Service: Session Server and IMAP Server

    E-Print Network [OSTI]

    Irvine, Cynthia E.

    Bryer-Joyner Brad Eads Scott D. Heller Cynthia E. Irvine Department of Computer Science Naval of user-friendly desktop en- vironments have resulted in system architectures unable to satisfactorily

  13. *Corresponding author. Fax: 7 3832 351771; e-mail: eolsh@thermo.isp.nsc.ru.

    E-Print Network [OSTI]

    Gusev, Guennady

    .M. Gusev , Z.D. Kvon , E.B. Olshanetsky *, D.K. Maude , X. Kleber , J.C. Portal Instituto de Fisica da Academy of Sciences, Siberian Branch, Pr. Lavrentjeva 13, Novosibirsk 630090, Russia CNRS-LCMI, F-38042

  14. James D. Van de Ven e-mail: vandeven@me.umn.edu

    E-Print Network [OSTI]

    Van de Ven, James D.

    and the transmissive part 2 . When these two parts are not in contact, conduction of the heat created by laser transmission weld to bridge a gap requires careful consideration of the heating distribution. The absorbing 55455 Bridging Gaps in Laser Transmission Welding of Thermoplastics Gaps at part interfaces pose a major

  15. Branching Decompositions of Necklaces William Y. C. Chen T-7, Mail Stop B284

    E-Print Network [OSTI]

    Chen, Bill

    @sun.nankai.edu.cn Jun Wang Department of Applied Mathematics Dalian University of Technology Dalian 116024 P. R. China Dalian University of Technology Dalian 116024 P. R. China email: junwang@dlut.edu.cn Suggested Running

  16. Nils Tngefjord Basse E-mail: nils.basse@npb.dk

    E-Print Network [OSTI]

    Basse, Nils Plesner

    confined fusion plasmas: Postdoctoral research Until the end of July 2005 I was a Postdoctoral Associate of the Optics and Plasma Research Department at the Risø National Laboratory in Roskilde, Denmark. My research

  17. Seth A. Lawson e-mail: seth.lawson9@gmail.com

    E-Print Network [OSTI]

    Thole, Karen A.

    that exist for utilizing available coal resources in a clean manner is coal gasification. Integrated gasification combined cycle IGCC power plants utilize coal gasification technology to produce hydrogen of Multiphase Particle Deposition on Endwall Film-Cooling Demand for clean energy has increased motivation

  18. SOLAR COOKER UTILIZING SATELLITE DISH TECHNOLOGY Mechanical Engineering Department , Philadelphia University, Amman Jordan, e-mail

    E-Print Network [OSTI]

    SOLAR COOKER UTILIZING SATELLITE DISH TECHNOLOGY A. Saleh1 A. Badran2 1 Mechanical Engineering dish­type solar cooker was built and tested utilizing satellite dish technology. A common satellite-TV dish was utilized as a solar cooker after covering it with a highly­reflective aluminum foil, which

  19. e-mail: zok@engineering.ucsb.edu A. G. Evans

    E-Print Network [OSTI]

    Zok, Frank

    of California, Santa Barbara, CA 93106 Design of Sandwich Panels With Prismatic Cores The paper focuses on optimization of lightweight sandwich panels with prismatic cores subject to bending loads in the two principal paper focuses on the design of such panels for maximum structural efficiency. Another paper has demon

  20. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Sheridan, Jennifer

    (Association of Engineering Geologists) Club Meeting Upcoming Events: · March 20, 2012 at 6pm in 2239, and geophysics of the Rocky Mountain region Engineering geology research (with no restriction on geographic area Resources Division is now recruiting for a Geologist/Geomorphologist · Postdoctoral Research Associate

  1. John Lorenz Sandia National Labora-tories, Mail Stop 0750, Albuquerque, New

    E-Print Network [OSTI]

    Lin, Andrew Tien-Shun

    work has focused on the Rocky Mountain region but has extended to reservoirs in other parts by a practiced author, is typically EDITOR'S NOTE Copyright #2003. The American Association of Petroleum Geologists. All rights reserved. AAPG Bulletin, v. 87, no. 4 (April 2003), pp. 529­533 529 #12;an achievement

  2. WebMail A to Z Contacts Site Map News Multimedia About Princeton

    E-Print Network [OSTI]

    Aksay, Ilhan A.

    power superfast airplanes Posted July 17, 2009; 12:26 p.m. by Chris Emery Supersonic aircraft may get will study how fuel additives made of tiny particles of graphene can help supersonic jets fly faster and make known as nanocatalysts can help supersonic jets fly faster and make diesel engines cleaner and more

  3. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Yu, Zhaoxia

    development and causes various preclinical and disease syndromes. Thus, the study of imprinting effects of complex diseases are known to have par- ent-of-origin effects, including asthma, autism, type I and type

  4. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    in sedimentology and stratigraphy, and geological mapping. Currently I am studying geology for the academic year interested in sedimentology and stratigraphy at Miami and have since taken additional courses at Trinity including sedimentology and stratigraphy, sedimentary petrology, and paleontology, paleoecology

  5. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    Professor, Sedimentology/Basin Analysis -Denison University · 2 PhD and 1 Post- University of Oslo JOB OPENINGS: Assistant Professor, Sedimentology/Basin Analysis -Denison University, to begin in August 2015. We seek a broadly trained scientist engaged in the study of Sedimentology and

  6. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Sheridan, Jennifer

    are highly multi-disciplinary, and combine petrology, mineralogy, meteorite impact studies, sedimentology or more of the above areas. Basic undergraduate coursework in mineralogy, petrology, and sedimentology

  7. -A Science Service mature 1 WHY THE WATHER 0 Mailed June 8, 1927

    E-Print Network [OSTI]

    Maui came t o the rescue. He s e t s i x snares of coconut fiber the sun16 path. When R a s t a r t e d

  8. e-mail sales@emcohighvoltage.com Web site www.emcohighvoltage.com

    E-Print Network [OSTI]

    Berns, Hans-Gerd

    is directly proportional to the input. Either output may be grounded to generate positive or negative high) 223-2779 11126 Ridge Road, Sutter Creek CA 95685 MODEL OUTPUT VOLTAGE OUTPUT CURRENT RIPPLE L03* 0.200% L30* 0 to 3,000 0.50mA 0.200% Low Noise, Proportional High Voltage Modules APPLICATIONS

  9. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    qualified, companies may move forward with lease acquisition and initial exploration drilling and ultimately-day shelf and deepwater Gulf. At these depths, reservoir quality is a critical risk factor. Petrographic

  10. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Finlay, Barbara L.

    respond principally to evo- lutionary issues of most relevance to read- ers of Brain, Behavior of `evo-devo'. In a pre-evo- devo context, when we first described the strong relationship between brain

  11. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Finlay, Barbara L.

    : 10.1159/000329851 Evo-Devo and Brain Scaling: Candidate Developmental Mechanisms for Variation term this approach `neuroecology'. More recently, the evo-devo approach has identified broadly vertebrates and invertebrates [Carroll, 2000]. Thus, the evo-devo ap- proach has been associated

  12. (Graduate School) (Address) (Contact person) TEL FAX E-mail Graduate Schools for Law

    E-Print Network [OSTI]

    Goda, Keisuke

    / TAKANO Yasuko(Ms.) http://www.m.u-tokyo.ac.jp/ 113-0033 7-3-1 Graduate School of Medicine http://www.m.u-tokyo.ac.jp/english/index.html information of the graduate schools, please refer to; http://www.u-tokyo.ac.jp/en/prospective-students/grad_students.html http://www.j.u-tokyo.ac.jp/is/gaikokujin.html http://www.j.u-tokyo.ac.jp/is/gaikokujin_e.html Please

  13. Corresponding author: Huosheng Hu E-mail: hhu@essex.ac.uk

    E-Print Network [OSTI]

    Hu, Huosheng

    ) ???­??? Using Echo Ultrasound from Schooling Fish to Detect and Classify Fish Types Yeffry Handoko1 , Yul of Essex, Wivenhoe Park, Colchester CO4 3SQ, UK Abstract Fish finders have already been widely available in the fishing market for a number of years. However, the sizes of these fish finders are too big

  14. Corresponding author: Huosheng Hu E-mail: hhu@essex.ac.uk

    E-Print Network [OSTI]

    Hu, Huosheng

    ­48 Biological Inspiration: From Carangiform Fish to Multi-Joint Robotic Fish Jindong Liu, Huosheng Hu School This paper presents a novel approach to modelling carangiform fish-like swimming motion for multi-joint robotic fish so that they can obtain fish-like behaviours and mimic the body motion of carangiform fish

  15. Philosophy Department Office Hours Name Office Ext. Office Hours E-Mail

    E-Print Network [OSTI]

    .lee@colorado.edu Lee, Mitzi HLMS 197 5-0661 Course Buyout mitzi.lee@colorado.edu Lowe, Dan HLMS 15 2-4883 MW 11, Graham HLMS 274 2-8449 Course Buyout oddie@colorado.edu Pasnau, Robert HLMS 276 2-4837 TF afternoons

  16. Israel Journal of Chemistry Vol. 43 2003 pp. 305317 *Authortowhomcorrespondenceshouldbeaddressed.E-mail

    E-Print Network [OSTI]

    Kling, Matthias

    , CA 94720, USA. Density-Dependent Photochemical Branching Ratio in Supercritical CO2) Abstract. The photodissociation of diiodomethane following excitation at 305 nm in supercritical CO2 isomer by energy transfer to CO2 in about 20­40 ps. Immediately after excitation, this band shows

  17. *Corresponding author. E-mail: kareem@navier.ce.nd.edu. Journal of Wind Engineering

    E-Print Network [OSTI]

    Kareem, Ahsan

    to improve its performance under wind and seismic loads. Completed in May 1993, the VIP lounge may experience towers have a distinct structural profile consisting of several structural shapes, e.g. circular observation decks and support systems with vertical or flared legs. Such a configuration often makes

  18. Public release date: 3-May-2012 [ Print | E-mail | Share ] [ Close Window

    E-Print Network [OSTI]

    Espinosa, Horacio D.

    , from large data servers to cars to cell phones. Their widespread integration is due in part in extreme environments such as high temperatures or radiation. In an effort to sustain the advance consumption and a strong tolerance of high temperatures and radiation exposure. Given their potential

  19. Corresponding author: Francois Barthelat E-mail: francois.barthelat@mcgill.ca

    E-Print Network [OSTI]

    Barthelat, Francois

    inclusions of large aspect ratio bonded together by a more ductile and tougher matrix. This seemingly simple and toughness. In this article we modeled the staggered structure using finite elements and small Representative provided the inclusions do not fracture in a brittle fashion. Interestingly the ends of the inclusions (the

  20. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Chen, Zhongping

    of the prosthesis is a custom-designed one-axis microelectromechanical system (MEMS) gyroscope. Similar employing commercial off- the-shelf microelectromechanical system (MEMS) gyro transducers and demonstrated Microelectromechanical system gyroscope Vestibular dysfunction Abstract This paper presents a functional architecture

  1. W. E. Dixon e-mail: wdixon@ces.clemson.edu

    E-Print Network [OSTI]

    Dixon, Warren

    University, Clemson, SC 29634-0915 Tracking and Regulation Control of a Mobile Robot System With Kinematic disturbances in the kinematic model. Through the use of a dynamic oscillator and a Lyapunov-based stability analysis, we demonstrate that the position and orientation tracking errors expo- nentially converge

  2. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  3. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)

    1999-04-01

    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  4. Haink C. Tu e-mail: tuxxx021@umn.edu

    E-Print Network [OSTI]

    Li, Perry Y.

    of Mechanical Engineering, University of Minnesota, 111 Church Street SE, Minneapolis, MN 55455 Design, Modeling, and Validation of a High-Speed Rotary Pulse-Width-Modulation On/Off Hydraulic Valve Efficient high-speed on unidirectional rotary valve designed for PWM is proposed. The valve is unique in utilizing the hydraulic fluid

  5. * Corresponding author. E-mail address: anna@engineering.ucsb.edu (A. Stefanopoulou).

    E-Print Network [OSTI]

    Stefanopoulou, Anna

    turbocharger. The variable geometry turbocharger allows the improvement of the steady-state ship hydrodynamic of turbocharged diesel engines render them common practice for the vast major- ity of ocean freighters and o!shore vehicles. In marine diesel propulsion, the turbocharger, the engine, and the propeller operation

  6. Titan ATEP Alum List 2012-13 LAST FIRST YR AFFILIATION SITE E-MAIL

    E-Print Network [OSTI]

    de Lijser, Peter

    Nixa, MO ccbeets@aol.com Belandres Melissa 03 Elk Grove, CA mbelandres@hotmail.com Benitez Evelyn 05 Health Fullerton, CA hlightle@fullerton.edu Callahan-Hill Diane 86 Centinial High School Corona, CA.com Chisar Michael 84 Diablo Valley College Pleasant Hill, CA mchisar@dvc.edu Chu-Coury Cindi 92 Coury

  7. E-mail: ragh@ces.iisc.ernet.in Indian Academy of Sciences

    E-Print Network [OSTI]

    Gadagkar, Raghavendra

    stalks its prey alone? Why are honey bee workers so industrious while the drones are so lazy? Why do for drones, of rearing sisters related to them by 0.5 instead of daughters related to them by 1.0? What

  8. DO NOT MAIL ORIGINAL REQUISITION IF FAXED TO PURCHASING THIS IS NOT A PURCHASE ORDER NUMBER

    E-Print Network [OSTI]

    (CONTINUED) TOTAL 13 ESTIMATED TOTAL OF THE REQUISITION / PO BU(2) ORG (5) FUND (4) ACTIVITY (5) PROJECT (8) FUND (4) ACTIVITY (5) PROJECT (8) ACCOUNT (5) A/U(1) YEAR(4 UNIT MEASURE ESTIMATED UNIT PRICE UNIT PRICE EXTENDED PRICE CATEGORY DESCRIPTION (VENDOR CATALOG

  9. ? WHY TWE WEATHER 7 Mailed September 14, 1932. By Charles Fitzhugh Talman,

    E-Print Network [OSTI]

    of Macedonia. rights rnserved by Science Service, Xnc.) SCIENGX SERVICE 2 l s t and Canstitution Ave

  10. Nazia Sarwat Islam e-mail: nazia1357@gmail.com

    E-Print Network [OSTI]

    Henkel, Werner

    on developing an audio annotation tool in Matlab 2010 Intern, Rahimafrooz Renewable Energy, Dhaka, Bangladesh Conference, New Delhi, India, 2007 Scholarship National Education Board, Dhaka, Bangladesh: National merit

  11. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Patel, Aniruddh D.

    ;75:85­9586 being (e.g. happiness, life purpose), and vice versa. The independence view, in contrast, asserts-being (depression, anxiety, anger) were assessed in a sample of aging women (n = 135, mean age = 74) on whom diverse

  12. D. Poulikakos1 e-mail: dimos.poulikakos@ethz.ch

    E-Print Network [OSTI]

    Daraio, Chiara

    In this paper, a thorough model for the porous diffusion layer of a polymer electrolyte fuel cell (PEFC

  13. e-mail: cxw31@psu.edu Department of Mechanical and Nuclear

    E-Print Network [OSTI]

    Wang, Chao-Yang

    and Nuclear Engineering, The Pennsylvania State University, University Park, PA 16802 Transport Phenomena graded materials (FGMs) is conducted. Focus is placed on understanding the interplay between the freezing front dynamics and particle transport during solidification. Transparent model experiments were

  14. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Boyd, Sunny K.

    in non-mammalian vertebrates. Nitric Received: September 5, 2006 Returned for revision: November 7, 2006 cochlear nucleus dcn dorsal column nucleus dp dorsal pallium dh dorsal habenula dHy dorsal hypothalamic of the solitary tract, octaval nuclei, and dorsal column nuclei of the medulla; and dorsal and motor fields

  15. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    /Geography at the Johann Wolfgang Goethe-University Frankfurt invites applications · Assistant Professor, Sedimentology for a faculty position in Geophysics, Sedimentology, or Geochemistry · Post-doc in experimental petrology - U geochemistry, low-temperature geochemistry, mineralogy, paleoclimatology, sedimentology and stratigraphy

  16. GEOBULLETIN GeoBulletin is distributed weekly, by E-mail. Contributions are requested!

    E-Print Network [OSTI]

    Carlson, Anders

    /Geography at the Johann Wolfgang Goethe-University Frankfurt invites applications · Assistant Professor, Sedimentology for a faculty position in Geophysics, Sedimentology, or Geochemistry · Post-doc in experimental petrology - U

  17. Fax +41 61 306 12 34 E-Mail karger@karger.ch

    E-Print Network [OSTI]

    Shorter, James

    Cellular existence demands that proteins fold into a multitude of diverse and elaborate structures to perform the vast majority of essential functions. Accordingly, vi- tiation of protein folding can have deleterious conse- quences [1­5]. Much of the information required for suc- cessful protein folding is encoded

  18. e-mail: lei.zuo@stonybrook.edu Pei-Sheng Zhang

    E-Print Network [OSTI]

    Zuo, Lei

    University of New York at Stony Brook, Stony Brook, NY 11794-2300 Energy Harvesting, Ride Comfort, and Road on a quarter car model predicts that 150 W of energy dissi- pated by shock absorbers can be converted that is available for harvest- ing in the vehicle suspension system and the tradeoff among energy harvesting, ride

  19. SUSSEX UNIVERSITY BOOKSHOP has been operating a successful International Mail-Order Service

    E-Print Network [OSTI]

    Sussex, University of

    indebted to my predecessor Rebekah Reid for handing over such an efficiently-run society. Rebekah, who

  20. : 210 772 2267 E-mail: mthanou@central.ntua.gr

    E-Print Network [OSTI]

    Psarrakos, Panayiotis

    ). . . : 4464-5 #12;6 (HTML/XHTML, HTML5, XML, XSL, CSS, JSON, SOAP/RESTful Web services, Ajax, j, XSL, DC, MARC, Z39.50, MODS .. - : C, Java, Php - : Oracle, MySql - : TCP/IP, WEB 2.0 02SQL) WEB (Apache Web Server, Tomcat Application Server). (Web 2

  1. *Corresponding author. Fax: 512-475-7824; e-mail: rochelle@ che.utexas.edu.

    E-Print Network [OSTI]

    Rochelle, Gary T.

    Cl\\ and high-temperature favor mercury absorption. Aqueous free Cl was the active species was measured in a stirred tank reactor at 25 and 55°C. NaOCl strongly absorbs Hg even at high pH. Low pH, high that reacted with mercury. However, chlorine desorption was evident at high Cl\\ and pH(9. Overall second

  2. Public release date: 12-Oct-2011 [ Print | E-mail | Share ] [ Close Window

    E-Print Network [OSTI]

    Sóbester, András

    by the petrochemical industries and to the methane which is naturally released from the seabed." Natural leaks gas leaks from pipelines, and methane naturally leaking from the seabed, could in future be detected of methane gas can be damaging to the environment because it is a greenhouse pollutant. The new acoustic

  3. Claire SCHEID E-mail : claire.scheid@cma.uio.no CMA, University of Oslo

    E-Print Network [OSTI]

    Chiron, David

    : A proof of the invariance of the contact angle in electrowetting, C. Scheid, P. Witomski, Mathematical temperatures" · "Molecular simulations : Theoretical and numerical aspects" · "Image analysis" 20022003 surfaces and functions of bounded variations. JuneJuly 2002: Internship, Institut Elie Cartan, Nancy

  4. Graduate Research Assistant e-mail: ht2288@columbia.edu

    E-Print Network [OSTI]

    Yao, Y. Lawrence

    strength is found to be a function of the fiber contact angle and packing density at the joint interface. Coupled heat transfer and viscous flow modeling is carried out to investigate the temperature and dynamics

  5. Commercial Feeding Stuffs Registered for Sale in Texas, October 1, 1919. 

    E-Print Network [OSTI]

    Fuller, F. D. (Frederick Driggs)

    1919-01-01

    STATION, BRAZOS COUNTY, TEXAS. STATION STAFFt ADMINISTI?ATION B YOUNGBLOOD M S Diredor A: B. CONNER. B. s.; 6$e Direeor J M JONES A. M.. Asszsiant Dtredor CHA~. A. FGLKER, Chief Clerk A. S. WARE, Secretary -, Executioe Assidant CHARLES SOSOLIK... bandman SUBSTATIONS No. 1. Beerille, Bee County No. 8. Lubbock Lubbock County I. E. COWAHT, M. S.. Superintendent R. E. KARPE;. B. S.. superintendent D. L. JONES, Scientific Assistant No. 2. Tronp, Smith County W. S. HOTCHKISS. Superintendent No. 9...

  6. Euphorbia hexagona (Native) 4 

    E-Print Network [OSTI]

    Amanda B. Cemper

    2011-08-02

    EXPERIMENT STATION AGRICULTURAL AND MECHANICAL COLLEGE OF TEXAS W. B. BIZZELL.' President BULLETIN NO. 293 FEBRUARY, 1922 DIVISION OFiHORTICULTURE CULTIVATION AND CARE OF TREES ON TEXAS FARMS B. YOUNGBLOOD, DIRECTOR, COLLEGE STATION, BRAZOS COUNTY..., Inspector SUBSTATIONS No. 1. Beeville, Bee County No. 8. Lubbock. Lubbock Counly I. E. COWART, M. S.. Superintendent R. E. KARPER, B. S.. Superintendent No. 2. Troup, Smith Connty W. S. HOTCIIKTSS. Superintendent No. 3. Angleton, Brazoria County V. E...

  7. Digestion Experiments With Texas Feeding Stuffs. 

    E-Print Network [OSTI]

    Fraps, G. S.

    1914-01-01

    ............................................................................................................ .00 7.03 7.03 Cottonseed meal, average 1913................................................................................... 38.55 18.31 27.37 7050-1 Cottonseed meal... NO. 7: Spur, D ickens County R . E. D i c k s o n , B. S., Superintendent SUBSTATION NO. 8: Lubbock, Lubbock County V. L. C o r y , B. S., Superintendent SUBSTATION NO. 9: Pecos, Reeves County H . C. S t e w a r t , B . S ., Superintendent J...

  8. In the Face of Neoliberal Adversity: Engaging Language Education Policy and Practices

    E-Print Network [OSTI]

    Davis, Kathryn A.; Phyak, Prem

    2015-01-01

    by the Superintendent of Education as circumstances warrant.2010). Revolutionizing education: Youth participatory actionNepal. Globalization, Societies and Education, 1(1), 87-101.

  9. DOE/EIA-0514(85

    U.S. Energy Information Administration (EIA) Indexed Site

    4(85 ) Energy Information Administratio n Manufact uring Energy Consump tion Survey: Method ologica l Report 1985 This publication is available from the Superintendent of...

  10. DOE/EIA-0515(85) Energy Information Administration Manufacturing...

    U.S. Energy Information Administration (EIA) Indexed Site

    5(85) Energy Information Administration Manufacturing Energy Consumption Survey: Fuel Switching, 1985 This publication is available from the Superintendent of Documents, U.S,...

  11. Many classroom lighting systems provide mediocre lighting quality and have high

    E-Print Network [OSTI]

    , superintendents, principals, architects, lighting designers, utility staff, and code officials can use information community and school officials about the system's availability. · Document system performance and occupant

  12. Name: MASIP BRUIN, Xavier (PhD in Telecommunications Engineering) E-mail address: xmasip@ac.upc.edu

    E-Print Network [OSTI]

    Masip Bruin, Xavier

    European Leadership", (NOBEL)", FP6-506760 Since January 2007 Participation in MCyT (Spanish government Participation in MCyT (Spanish government) project: CATARO, TEC2005-08051-C03-01. Since December 2005 Participation in MCyT (Spanish government) project: "Provisión de servicios de red interdominio", TSI2005

  13. Web Page: http://nuclearphysics.nuclear.lu.se/nosa/ E-mail: nosa2001@nuclear.lu.se

    E-Print Network [OSTI]

    Mironova, Irina A.

    of Technology, Lund, Sweden. The Aerosol Group at the Division of Ergonomics and Aerosol Technology, Department President) Bengt Martinsson, Div. of Nuclear Physics, Lund University Mats Bohgard, Div. of Ergonomics and Aerosol Technology, Lund University Anders Gudmundsson, Div. of Ergonomics and Aerosol Technology, Lund

  14. Changhuei Yang 1200 E. California Blvd, MC: 136-96 e-mail: chyang@caltech.edu

    E-Print Network [OSTI]

    ) 4. Changhuei Yang, Kyungwon An, Lev T. Perelman, Adam Wax, Ramachandra R. Dasari and Michael S. Feld. Changhuei Yang, Adam Wax, Irene Georgakoudi, Eugene B. Hanlon, Kamran Badizadegan, Ramachandra R. Dasari). 6. Changhuei Yang, Adam Wax and Michael S. Feld; "Measurement of anomalous phase velocity

  15. Technische Universitt Mnchen Corporate Communications Center 80290 Mnchen www.tum.de Name Funktion Telefon E-Mail

    E-Print Network [OSTI]

    Kemper, Gregor

    . "EVA" showcases a new super-fast charging system recharging the battery within 15 minutes, a range of 200 kilometers and an individual air conditioning. TUM CREATE is a common research project such as individualized overhead air- conditioning. "This new electric taxi for tropical mega cities, developed

  16. New permanent home address New seasonal home address:New paycheck mailing address Employee Information Update Form

    E-Print Network [OSTI]

    Post, David M.

    /OTHERS/CONTACT window Optional: enter new Spouse directory listing information. Is spouse a Yale employee? Spouse Last Employee Information Update Form Complete only those items that are being changed. Items in bold are used to update the Yale University Directory. Prepared by: Name Department Phone Date Submitted Effective Date

  17. Academic Affairs, Provost and Vice Chancellor Office: 910-962-3137 Fax: 910-962-3922 Mail Code: 5900

    E-Print Network [OSTI]

    Scharf, Fred

    Employee 23681 Jarvis, Mandie Temporary SPA Employee 22597 Lee, Elizabeth Temporary SPA Employee 24258 Martin, Robin Temporary SPA Employee 24258 Nance, Lisa Temporary SPA Employee 24258 7/4/2015 9:00:11 PM UNCW Telephone Directory Alphabetical Listing by Department #12;Academic Affairs, Resource Management

  18. What's in Season from the Garden State To receive these reports by e-mail: njfarmfresh@rcre.rutgers.edu

    E-Print Network [OSTI]

    Goodman, Robert M.

    and mixed them with dried meat to create "pemmican". It's medicinal and long-lasting properties weren't lost are flooded for wet harvest culture, and to provide an insulating layer from winter freezing. Since it takes

  19. *Corresponding author. Fax: #(44)-01483-450984. E-mail address: e.savory@surrey.ac.uk (E. Savory)

    E-Print Network [OSTI]

    Savory, Eric

    in a crosswind Eric Savory*, Norman Toy Fluid Mechanics Research Group, School of Engineering in the Environment#ected by a crosswind. The method requires a much smaller experimental data set than would otherwise be necessary-"eld behaviour 1. Introduction The behaviour of a plume issuing vertically and nor- mally into a crosswind may

  20. *Corresponding author. Fax: #81-3-5384-6114. E-mail address: furukawa@phys.aoyama.ac.jp (N. Furukawa)

    E-Print Network [OSTI]

    Heermann, Dieter W.

    -wave superconductivity (d-SC) but is dominant due to the next leading divergent terms. The uniform charge susceptibil

  1. Indiatimes | My Mail | Make Indiatimes your home page | Hi Guest, Sign Up | Sign In Saved Article(s) Archives

    E-Print Network [OSTI]

    Rogers, John A.

    . Start Power-Sourcing w/ Avnet Today www.EM.Avnet.com/StandardProducts LED Signs For Business Buy? Is CBSE right in banning cellphones in schools? Do you agree with CBSE that mobile phones

  2. MAIL/RETURN TO: UC San Diego Parent & Family Programs 9500 Gilman Drive, #0015, La Jolla, CA 92093

    E-Print Network [OSTI]

    Tsien, Roger Y.

    Year/Junior Fourth Year/Senior College (check one): Revelle College John Muir College Thurgood Marshall) (Last Name) Student Year (check one): First Year/Freshman Transfer/Freshman Second Year/Sophomore Third

  3. e-mail : kkt14418@hanmail.net, sbahk@snu.ac.kr Neighbor-aware Adaptive Load Balancing Algorithm

    E-Print Network [OSTI]

    Bahk, Saewoong

    is suitable for dense wireless sensor networks that network environment is changeable. I. . , , . . . . II. 2.1 . Tree Construction(TC) Neighbor Information(NI), Probability] Wei Ye, John Heidemann, and Deborah Estrin," "Medium access control with coordinated, adaptive

  4. *Corresponding author. Fax: #1-315-268-3833. E-mail address: regel@clarkson.edu (L.L. Regel).

    E-Print Network [OSTI]

    Regel, Liya L.

    to form an ideal solution, where R is the ideal gas constant and v is the molar volume (here assumed in brackets in Eq. (2) is associated with the energy densities due to the individual Helmholtz free energy to be constant and the same for both components). The free energy for the solid phase can be written in a form

  5. Office: 1321 Old Main; 313-577-1795; e-mail: music@wayne.edu Chairperson: John D. Vander Weg

    E-Print Network [OSTI]

    Berdichevsky, Victor

    Collins (Jazz Stud- ies), Dennis Tini (Music Business and Music Technology), Terese Volk Tuohey (Music Oien (clarinet, DSO), Robert Pipho (jazz theory), Donald Platter (wood- winds), Dan Pliskow (jazz bass

  6. The American Genetic Association 2014.All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

    E-Print Network [OSTI]

    Jones, Adam

    ); and the Centro de Investigaciones Científicas de las Huastecas "Aguazarca," Calnali, Hidalgo, Mexico (Passow, swordtail Individual reproductive success is shaped by a number of fac- tors, including ecological, social, hybridization may impact phe- notypic diversity in traits linked to sperm competitive ability (Joly et al. 1997

  7. Department Name Department Head DCLs -email -Phone Authorized Person Fiscal -Email -Phone Other Approved Persons -E-mail -Phone

    E-Print Network [OSTI]

    Pittendrigh, Barry

    Michael Beach Kathy Vanderwall (UR) kvanderwall@purdue.edu 44765 Brad Pape (PMU) bcpape@purdue.edu 48961@purdue.edu 44765 Brad Pape (PMU) bcpape@purdue.edu 48961 Randi Purvis(Primary UR) purvisr@purdue.edu 41000 Missy Wilson (Secondary UR) mlwilson@purdue.edu 41037 Bob Mindrum (PMU) mindrum@purdue.edu 48901 Kathy

  8. Averting Our Eyes E-mails received regarding the letter from the National Mining Association CEO and my

    E-Print Network [OSTI]

    Hansen, James E.

    peak production of both oil a burn all of the fossil fuels (oil, gas, coal and unconventional fossil fuels such as tar shale and tar in the air today is due about 50% to coal, 35% to oil and 15% to gas. The annual increments for the past few

  9. *Corresponding author. Fax: #39-0862-437570. E-mail address: stefano.pirro@lngs.infn.it (S. Pirro).

    E-Print Network [OSTI]

    Abstract Present results on neutrinoless double beta decay of Te obtained with an array of 20 cryogenic array, corresponding to 1.5 kg yr, a limit on neutrinoless double beta decay half-life of 9.5;10 yr (90. The advantages of using large mass, high resolu- tion detectors to search for neutrinoless double beta decay (0

  10. Department of Geography, University of North Carolina, NC, USA e-mail: csong@email.unc.edu

    E-Print Network [OSTI]

    Song, Conghe

    development of forest cover with the economic growth as environ- mental Kuznets curve (Stern et al. 1996

  11. 67107Federal Register / Vol. 69, No. 220 / Tuesday, November 16, 2004 / Proposed Rules E-mail: 0648

    E-Print Network [OSTI]

    for grouper in the Gulf of Mexico is managed under the Fishery Management Plan for the Reef Fish Resources of the Gulf of Mexico (FMP). The FMP was prepared by the GMFMC, and implemented under the authority in the Gulf of Mexico grouper fishery by further restricting the number of participants. The GMFMC has been

  12. 2010 33 1 e-mail: moheo@bi.snu.ac.kr, btzhang@bi.snu.ac.kr

    E-Print Network [OSTI]

    ) ( ) . (7) 1- (, ) (7) . (8) 1- , (C 200 250 300 350 400 450 500 k=5 k=10 k=20 k=30 k=40 k=50 k=60 , ( ) 0ii n f p > 2.9901 175 499.9850 (0.1216) = 0.01 1000 thR 3. ( 500, 1000, =0.01) , . 2

  13. F:\\Website\\Vet Med students\\vetmed_health_history_20152016.docx Return completed form by mail to

    E-Print Network [OSTI]

    Tullos, Desiree

    receive to relieve your allergies: 3. Do you have asthma? If yes, list the cause(s) of asthma (if you do:\\Website\\Vet Med students\\vetmed_health_history_20152016.docxc ENVIRONMENTAL ALLERGIES/ASTHMA Yes No 1. Do you have not know, write unknown): List symptoms that occur when you are suffering from asthma: Severity of Symptoms

  14. -Author to whom correspondence should be addressed. E-mails: hgintis@mediaone.net; easmith@u.washington.edu;

    E-Print Network [OSTI]

    Smith, Eric Alden

    at http://www.idealibrary.com on Costly Signaling and Cooperation HERBERT GINTIS*-, ERIC ALDEN SMITH; Nowak & Sigmund, 1998; Wedekind & Milinski, 2000; Leimar & Hammer- stein, 2001), and multilevel

  15. Mail all packages to Cherry Convention Services at the address given below by Wednesday, September 3rd.

    E-Print Network [OSTI]

    Li, Mo

    , September 3rd. Packages arriving after Friday, September 5th are not guaranteed to be at the Career Fair

  16. *Correspondence. E-mail: pnarr.henriquesf@icn.pt Tel.: + 351 21 2189791, Fax: + 351 265 541155

    E-Print Network [OSTI]

    Scotland to Senegal including Madeira and the Canary islands, and in the western Mediter- ranean eastward and the Canary Islands while L. candollei is the most widespread species, being present in the Atlantic coasts from England to Senegal, in Madeira and the Canary Islands and throughout the Mediterranean. Prior

  17. 2015 Faculty Senate Roster (alphabetical) lastname firstname College Dept Mail Code Email Phone FS Cm Term Ends

    E-Print Network [OSTI]

    Azevedo, Ricardo

    /15/2016 Bachman Leonard ARCH ARCH 4000 lbachman@central.uh.edu 713-743-2372 UC 8/15/2016 Back Ki-Joon HRM HRM 3028 kback@uh.edu 713-743-7371 GPSC 8/15/2015 Barth Stephen HRM HRM 3028 SCBARTH@CENTRAL.UH.EDU 713

  18. Corresponding author's e-mail: n-tregger@northwestern.edu Page 1 Corresponding author's fax: 847-491-4011

    E-Print Network [OSTI]

    pastes employed for rheology tests consisted of Type I Ordinary Portland Cement, Class C fly ash, water.55 % by weight of solids). The fly ash volume replacement ratio was kept constant at 30% for all the mixes protocol was adopted: cement and fly ash were placed together with wa

  19. Office: 1321 Old Main; 313-577-1795; e-mail: music@wayne.edu Chairperson: John D. Vander Weg

    E-Print Network [OSTI]

    Berdichevsky, Victor

    in an urban cul- tural setting. With close proximity to Detroit's cultural center, students have access to the resources of such premiere institutions as the Detroit Institute of Arts, the Detroit Public Library, the Detroit Opera Ho

  20. Geochemical Journal, Vol. 38, pp. 363 to 381, 2004 *Corresponding author (e-mail: baozw@gig.ac.cn)

    E-Print Network [OSTI]

    Long, Bernard

    during hydrothermal alteration. However, rare earth elements (REE) were mobile. Light rare earth elements (LREE) were depleted, whereas heavy rare earth elements (HREE) were enriched. A differentiation not have been the main source of the PGEs and gold in the SRHDG deposits. Rather, these metals were derived

  1. *Corresponding author: Tel. +44 1865 283490 E-mail address: alan.cocks@eng.ox.ac.uk

    E-Print Network [OSTI]

    Fleck, Norman A.

    a Department of Engineering Science, University of Oxford, Parks Road, Oxford OX1 3PJ, UK b Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ, UK c Siemens AG, Corporate-based gas turbines. The APS coating comprises an assembly of zirconia splats, with intervening cracks

  2. For additional information, please e-mail ctsc_noveltech@med.cornell.edu REQUEST FOR CTSC 3D PRINTING APPLICATIONS

    E-Print Network [OSTI]

    Chen, Tsuhan

    for commercialization 3D Printing Novel Technology Award $10,000 (direct costs) with use of the New CTSC 3D Printing with 3D printing technology in order to rapidly develop novel biomedical products with application) and importance of funding to feasibility of the project Research Plan (use of the CTSC 3D Printing Core Facility

  3. Degrees of Orality in Speech-like Corpora: Comparative Annotation of Chat and E-mail Corpora

    E-Print Network [OSTI]

    Eckhard Bick Institute of Language and Communication, University of Southern Denmark Campusvej 55, DK 5230 in a speech-like fashion, without the constraints of ordinary written production, thus in fact providing://www.cs.cmu.edu/~enron/). The data was originally made public, and posted to the web, by the (US) Federal Energy Regulatory

  4. GO Kids | GO Family | GO Money | GO Sports | GO Home ABOUT GO NETWORK | SIGN IN | FREE E-MAIL

    E-Print Network [OSTI]

    Wilf, Peter

    , and vice versa. Time Travel To examine climate change apart from latitude, the scientists sort of time: The Search for E.T. Warm Times Mean More Bugs Menstrual Cycles Affect Women's Preferences Seeking Relief

  5. Q-Assistierende bei den Fakultten Name Vorname Titel Institut / Verantwortungsbereich Adresse PLZ, Ort Telefon E-Mail

    E-Print Network [OSTI]

    Sola, Rolf Haenni

    Sozialwissenschaftliche Fakultät Herzog Daniela Institut für Unternehmensführung und Marketing Engehaldenstrasse 4 3012.cormier@histdek.unibe.ch Philosophisch-humanwissenschaftliche Fakultät Hussmann Madeleine Institut für Psychologie Fabrikstrasse 8 3012 Fabrikstrasse 8 3012 Bern 031 631 55 51 diana.romano@psy.unibe.ch Hollenstein Armin Prof. Dr. Institut für

  6. Akhil Mathur Contact E-mail: akhilmathurs@gmail.com Website: http://www.dgp.toronto.edu/akhil

    E-Print Network [OSTI]

    Toronto, University of

    ) [P3] Kam M., Agarwal A., Kumar A., Lal S., Mathur A., Tewari A., Canny J. Designing E-Learning Games on Designing Interactive Systems (DIS '08) [P2] Kam M., Bhagwani S., Kumar A., Lal S., Mathur A., Tewari A and Communication Technologies and Development (ICTD '07) [P1] Tewari A., Kumar A., Mathur A., Lal S., Kam M., Canny

  7. Technische Universitt Mnchen Corporate Communications Center 80290 Mnchen www.tum.de Name Funktion Telefon E-Mail

    E-Print Network [OSTI]

    Cremers, Daniel

    naturwissenschaftlichen Grundlagen zu anwendungsorientierten Themen in Ernährung, Landnutzung und Umwelt. Derzeit werden 3

  8. NOAA Technical Report NMFS SSRF-721 National Marine Fisheries

    E-Print Network [OSTI]

    . January 1972, iii + 16 p., 7 figs., 3 tables. For sale by the Superintendent of Documents, U.S. Government of ran- cidity in Spanish mackerel \\Scomberornorus maculatus) during frozen storage By Robert N Farragut. February 1972, i\\ + 12 p., 6 figs., 12 tables. For sale bv the Superintendent of Documents, U.S. Government

  9. L-l U I S:. NOAA Technical Report NMFS SSRF-726

    E-Print Network [OSTI]

    tables. For sale by the Superintendent of DiKuments. U.S. Government Printing Office, Washington, D by the Superintendent of Documents, U.S. Government Printing Office, Washington, D.C. 20402. 650. Effects of some antioxidants and EDTA on the development of ran- cidity in Spanish mackerel (Scomberomorus maculatus) during

  10. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report-Fisheries

    E-Print Network [OSTI]

    . For sale by the Superintendent f DocLments, US. Government Printing Office, Washington, D.C. 20402. Ii50 Effects of some antioxidants and EDTA on the development ofran- cidity m Spanish mackerel (ScomberomorusJle For Qale by the Superintendent of Documents, U.S. Government Prin mg Off ce, Washington, DC 20402. IX

  11. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report-Fisheries

    E-Print Network [OSTI]

    tables. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington, D.C. 20402. 6.50. Effects of some antioxidants and EDTA on the development of ran- cidity in Spanish mackerel tahles. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington, D

  12. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report--Fisheries

    E-Print Network [OSTI]

    tables. For sale by the Superintendent of Documents, U.S. Government Printing Office. Washington. D by the Superintendent of Documents. U.S. Government Printing Office, Washington, DC. 20402. 650. Effects of some antioxidants and EDTA on the development of ran- cidity in Spanish mackerel iScomberomorus macutatus) during

  13. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report-Fisheries

    E-Print Network [OSTI]

    figs.. 3 tables. For sale by the Superintendent ,,' Drcuments. t.; S Government Printing Office, in Spanish mackerel (Scomberom"rus maculatus) during frozen t \\'lge Bv Rohert :\\". Farragut. February 1972. iv + 12 p.. 6 figs., 12 ta"les F,r sale by the Superintendent of Documents, l 'B. Government Prln

  14. NOAA Technical Report NMFS SSRF-710 Midwater Invertebrates from

    E-Print Network [OSTI]

    . January 1972, iii + 16 p., 7 figs.. 3 tables. For sale by the Superintendent of Documents, U.S. Government 1973. iii + 13 p.. 1 fig. For sale by the Superintendent of Documents, U.S. Government Printing Office in Spanish mackerel (Scomberomorus maculatus) during frozen storage. By Robert N. Farragut. February 1972, iv

  15. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report-Fisheries

    E-Print Network [OSTI]

    tables. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington D.C. 20402. 650. Effects of some antioxidants and EDTA on the development ofran- cidity in Spanish mackerel tables. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington, D

  16. NOAA TECHNICAL REPORTS National Marine Fisheries Service, Special Scientific Report-Fisheries

    E-Print Network [OSTI]

    tables. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington, D.C 20402. 650 Effects of some antioxidants and EDTA on the development of ran- cidity in Spanish mackerel tables. For sale by the Superintendent of Documents, U.S. Government Printing Office, Washington, D

  17. The Campus Level Effectiveness of the Texas Foundation School Program: A Policy Analysis Focusing On Texas Campuses 

    E-Print Network [OSTI]

    West, William Keith

    2013-06-17

    Independent School District were a constant source of encouragement. Superintendent Keith Smith and Assistant Superintendent Dr. Robert Cope were instrumental in allowing me to see this project through to completion. Without them, managing my professional... Finance Litigation with a Focus on Texas ............................ 26 The FSP as Policy: Philosophy, Structure, and Function .................................... 37 Equity and its Role as a Key School Finance Construct...

  18. The Effect of Sulphur on Yield of Certain Crops. 

    E-Print Network [OSTI]

    Reynolds, E. B. (Elbert Brunner)

    1930-01-01

    , Reeves County: No. 2 I, -------- J. J. BAYLES, B. S., Superintendent -. Superintendent Teachers in the School of Agriciltnrz Cari-yinz Cooperative Projlcts on the Station: G. W. ADRIANCE, M. S., Horticulture A K. MACKEY M. S. Animal Husbandry S. W...

  19. habitat (Native) 22 

    E-Print Network [OSTI]

    James R. Manhart

    2011-08-10

    ., Superintendent No. 2. Tyler. Smith County: No. 10. College Station, Rrazos County: P. R. Johnson, M. S., Superintendent R. M. Sherwood, M. S., In Charge **B. H. Hendrickson, B. S., Sci. in Soil Erosion L. J. McCall, Farm Superintendent "R. W. Baird, M. S...., Veterinarian Clarice Mixson, B. A.. Secretary **I". P. Mathews, D. V. M., M. S., Veterinarian M. P. Holleman, Chief Clerk Plant Pathology and Physiology.: D. R. McDonald, Asst. Chief Clerk J. J. Taubenhaus. Ph. D., Ch~ef Chester Higgs, Executive Assistant W...

  20. Little Belt Mountains folio, Montana 

    E-Print Network [OSTI]

    Weed, Walter Harvey, 1862-1944.

    1899-01-01

    . Hall, B. S., Superintendent J. J. Bayles. B. S.. Superintendent No. 2. Lindale. Smith County: No. 10. College Station. Brazos County: P. R. Johnson, M. S.. Superintendent R. M. Sherwood. M. S., In Charge **B. H. Hendrickson. B. S.. Sci. in Soil... Note:-The weight of the dry plant is expressed in its equivalent of green plant. LOCOISM 'IN DOMESTIC ANIMALS 11 lots with four animals to the lot. The animals in lots 1 and 2 were fed individually. The daily ration of loco plant for the animals...

  1. FISH COOKERY FOR ONE HUNDRE D

    E-Print Network [OSTI]

    , Secretary UNITED STATES GOVERNMENT PRINTING OFFICE WASHINGTON ; 1956 For sale by the Superintendent 01 Documents , U. S. Government Printing Office Washington 25 , D. C. - Price 30 cents #12;ACKNOWLEDGMENT . . .. . .. ... .. ... .... . Spanish sauce ................ ... . . .. . . ....... . ... .... .. . Lemon parsley butter . Drawn butter

  2. Fruit and Spice Park Park n r a n

    E-Print Network [OSTI]

    Koptur, Suzanne

    in 1924 and organi ed in 1926. n 1944 Mar Heinlein ecame the rst Superintendent of the Redland Fruit on claims rought children with them. The pro lem of schooling ecame acute. an and Annie Ro erts donated

  3. Malus domestica cv. Granny Smith (Cultivated) 

    E-Print Network [OSTI]

    James R. Manhart

    2011-08-10

    This study examines the historical significance of the Virginia Military Institute�s (VMI) first superintendent, Francis Henney Smith, and his influence not only at his home institution but also on his broader social, educational, and political...

  4. Green Supers Graduate Prepared to Make NYC More Energy Efficient

    Office of Energy Efficiency and Renewable Energy (EERE)

    Secretary Chu delivered the graduation address for the Green Supers program in New York City. The 40-hour program teaches building superintendents everything they need to know about green building operations and maintenance.

  5. Marine Fisheries On the cover: Transmission electron micro-

    E-Print Network [OSTI]

    Marine Fisheries ~@WD@~ On the cover: Transmission electron micro- graph of a myxosporidian. Kudoa by the Superintendent of Documents, U.S. Government Printing Office, Washington. DC 20402. Prices are: Single copy. $3. Washington. DC 20260. #12;

  6. Perceptions of Administrators on the Use of Distance Education in Texas Public Schools 

    E-Print Network [OSTI]

    Rabroker, Raymond Bernard Jr.

    2012-02-14

    to the implementation of distance education. The study included a series of 17 interviews with school principals and superintendents. Based on these interviews, a survey instrument was developed and sent to a larger sample of administrators. The sample population...

  7. The Effects of Elite Decision Making 

    E-Print Network [OSTI]

    Johansen, Morgen S.

    2010-07-14

    and superintendents on performance. I also examine the effect of principals within in the organization, namely how principals affect the turnover of the workers under them. Results find that principals have a direct and beneficial influence on organizational...

  8. Cash Flow Defining The Construction Industry 

    E-Print Network [OSTI]

    Nair, Shalini

    2015-08-06

    management level. The personal responsibility levels are moderate and the returns based on the decisions made are sometimes hard to determine. The developed game rules model such a situation, providing a Superintendent with a scenario to control cash flow...

  9. MARY CARROLL CRAIG BRADFORD: PROVIDING OPPORTUNITIES TO COLORADO’S WOMEN AND CHILDREN THROUGH SUFFRAGE AND EDUCATION 

    E-Print Network [OSTI]

    Caldwell, Heather K.

    2010-07-14

    and analyzing many documents. Data was found in the town of Leadville, Colorado, where she first lived and in the archives in Denver, Colorado, where she lived the remainder of her days. Pictures, letters, newspaper clippings, superintendent reports and various...

  10. Cost Comparison of Public Elementary School Construction Costs Based on Project Delivery System in the State of Texas 

    E-Print Network [OSTI]

    Reinisch, Ashley

    2012-02-14

    the relationship between cost and project delivery systems. A survey was sent to all school superintendents in Texas requesting recent data on elementary school enrollment, project delivery type and construction costs. One hundred and thirty six responses were...

  11. An analysis between teacher trust in the principal and teacher burnout as identified by teachers in selected Texas public schools 

    E-Print Network [OSTI]

    Ceyanes, Jason W.

    2006-04-12

    Developing trusting relationships and reducing teacher burnout are two pressing issues that principals and superintendents confront on a daily basis in public schools. With the increasing demands of state mandated testing, No Child Left Behind...

  12. Pyrtle Community Women 

    E-Print Network [OSTI]

    2009-01-01

    The purpose of this study was to determine which management and leadership behaviors selected superintendents perceived as critical to the position of principal. Differences were examined by gender as well as size of district. A secondary goal...

  13. The Influence of Individuality, Age, and Season Upon the Weights of Fleeces Produced by Range Sheep. 

    E-Print Network [OSTI]

    Lush, Jay L. (Jay Laurence); Jones, J. M. (John McKinley)

    1923-01-01

    . WOOD, Inspector J. J. KELLY, Inspector J. D. PREWIT, B. S., Inspector 13. W. CARLETON, B. S., Inspector SUBSTATIONS No. 1. Beeville Bee County No. 10. College Station, Brazos County I. E. COWART,' XI. S., Superintendent ' (Feeding and Breeding...

  14. Creeping bentgrass performance, water relations, and soil gas response to three irrigation frequencies in a hot-humid climate 

    E-Print Network [OSTI]

    Jordan, John Ellis

    1998-01-01

    Golf course superintendents in the southern United States need all the help they can get when managing bentgrass on sand-based profiles during stressful summer months. Help in the form of increased shoot and root density, ...

  15. Francis H. Smith: architect of antebellum southern military schools and educational reform 

    E-Print Network [OSTI]

    Wineman, Bradford Alexander

    2006-10-30

    This study examines the historical significance of the Virginia Military Institute�s (VMI) first superintendent, Francis Henney Smith, and his influence not only at his home institution but also on his broader social, educational, and political...

  16. Denman Forestry Issues Series presents: "Seeking Sustainability"

    E-Print Network [OSTI]

    Brown, Sally

    Ecosystems, and National Parks - William Paleck, Superintendent, North Cascades National Park, U.S. Park Forested Urban Environments - Libbie Soden, Urban Forestry, City of Everett, WA 12:10 - 12:30 Industry

  17. www.dodge.com/sprinter Feedback -Ads by Google Printer-friendly E-mail this article Daily News Email Digest

    E-Print Network [OSTI]

    Braun, Paul

    for Business News) New technology aims to cool hot chips Posted: Jan 8th, 2008 New membranes improve carbon by the telecommunications industry for transmissions through fiber-optical cables," Braun said. "Creating these waveguides, Illum Design LED Illumination, Plastic Lenses www.smaoptical.com CSM Instruments Instruments for surfa

  18. 2015 Venture Junior Counsellor Leadership Program Application Please fill out the following application and submit by e-mail, by Wednesday, February 18, 2015.

    E-Print Network [OSTI]

    Haykin, Simon

    Gluten Free Other List Other Dietary Restrictions: Residence Roommate Request: You may request one other

  19. *Corresponding author. Address for correspondence: Department of Statistics, Pennsylvania State University, State College, PA 16802-2111, USA, e-mail: kundu@stat.psu.edu.

    E-Print Network [OSTI]

    Kundu, Debasis

    *Corresponding author. Address for correspondence: Department of Statistics, Pennsylvania State is supported by a grant No. (SR/O½/M -- 06/93) of the Department of Science and Technology, Government of India of Atomic Energy, Government of India. Presently at the Reserve Bank of India. Signal Processing 72 (1999

  20. * Corresponding author. Tel.: #852-2788-7812; fax: #852-2788-7830. E-mail address: peter.yu@cityu.edu.hk (K.N. Yu)

    E-Print Network [OSTI]

    Yu, Peter K.N.

    to estimate the radiation dose received by the human body, the most readily available parameters built near to Hong Kong has gone into operation in 1994. In spite of the very low probability of having values were also discussed in other publications (IAEA, 1982; NCRP, 1984). Further research (Ng, 1982

  1. Please print out this form and mail it along with your credit card information, money order, or cheque to: University Extension Press

    E-Print Network [OSTI]

    Saskatchewan, University of

    , or cheque to: University Extension Press University of Saskatchewan 237­221 Cumberland Avenue North of the University Extension Press, returns will no longer be accepted. The only exception will be for defective/damaged items. University Extension Press must be notified within one week of shipping and prior to return

  2. * Corresponding author. Tel.: #44-1603-592648; fax: #44-1603-507719. E-mail address: d.bakker@uea.ac.uk (D.C.E. Bakker).

    E-Print Network [OSTI]

    Watson, Andrew

    with additional iron infusions after 3, 5 and 7 days. A small decrease of the fugacity of carbon dioxide (fCO ) and dissolved inorganic carbon (DIC) by iron-induced algal growth was observed 4}5 days after the "rst infusion

  3. Bld No Property Description Chief Warden E-Mail Phone 1 University House Tony Karrys tony.karrys@anu.edu.au 55269

    E-Print Network [OSTI]

    .Heskins@anu.edu.au 52053 18 / 20 University Union Rod Thomas Rod.Thomas@anu.edu.au 52182 25A HW Arndt Don Puttick Donald - Faculties Jan Elliott Jan.Elliott@anu.edu.au 56422 43 W.K. Hancock Building - Life Sciences/CRES Chris

  4. Secretara de AGE -FSP-UGT Avda. de Amrica, 25 3 planta-28002 Madrid-Tfno.: 915897238 Fax: 915897236 e-mail: age.federal@fsp.ugt.org

    E-Print Network [OSTI]

    Fitze, Patrick

    borradores para hacer alegaciones y que esa Central Sindical no las había mandado en cualquier caso se toma palabra el Jefe de Relaciones Laborales indicando lo contraproducente que es el presente acuerdo para el sistema preventivo del CSIC ya que entre otras cosas parte en dos áreas el país Madrid y provincia y el

  5. Coal River Mountain Redux Below is an update to the Coal River Mountain story that I described earlier in an e-mail, in an

    E-Print Network [OSTI]

    Hansen, James E.

    Coal River Mountain Redux Below is an update to the Coal River Mountain story that I described billion gallons of toxic coal sludge located directly above Marsh Fork Elementary School. (No word yet on their campus a couple of years ago. Underground Appalachian coal mining is being replaced in recent years

  6. 167Thermomagnetic treatment of zinc: selective grain growth and texture modification Corresponding author: A.D. Sheikh-Ali, e-mail: a.sheikh-ali@kbtu.kz

    E-Print Network [OSTI]

    Garmestani, Hamid

    of Kazakhstan 2 Institut für Metallkunde und Metallphysik, RWTH Aachen, D-52056 Aachen, Germany 3 Georgia

  7. PO Box 756 Winthrop, WA 98862 -Phone (509) 422-0300 -Cell (509) 429-1232 Fax (509) 422-1766 -e-mail msrf@communitynet.org

    E-Print Network [OSTI]

    and by the MVID to implement the project and manage all received funding. Our primary focus in undertaking summer push-up dam, which hinders upstream migration of Chinook, steelhead, and bull trout, or even blocks migration completely during exceptionally dry years. The proposed project will eliminate the need

  8. How to file a FOIA request for NASA Agency records A FOIA request for NASA Agency records must include the requester's name and mailing address, a description of

    E-Print Network [OSTI]

    How to file a FOIA request for NASA Agency records A FOIA request for NASA Agency records must is submitted online via the NASA FOIA website, the required information must be completed. Do not include a social security number on any correspondence with the FOIA office. NASA does not have a central location

  9. How to file a FOIA request for NASA Agency records A FOIA request for NASA Agency records must include the requester's name and mailing address, a description of

    E-Print Network [OSTI]

    How to file a FOIA request for NASA Agency records A FOIA request for NASA Agency records must is submitted online via the NASA FOIA website, the required information must be completed. Do not include a social security number on any correspondence with the FOIA office. NASA has a central location

  10. * Corresponding author. Tel.: 001-302-831-0049; fax: 001-302-831-E-mail addresses: willett@udel.edu (W. Kempton), tkubo@aceee.org

    E-Print Network [OSTI]

    Firestone, Jeremy

    @udel.edu (W. Kempton), tkubo@aceee.org (T. Kubo) Energy Policy 28 (2000) 9}18 Electric-drive vehicles for peak Electric-drive vehicles (EDVs), whether based on batteries, engine-electric hybrid, or fuel cells, could vehicles are typically parked throughout peak electrical demand periods. Using Ministry of International

  11. * Corresponding author. Tel.: #39-06-30483692; fax #39-06-30486405. E-mail address: pirozzi@casaccia.enea.it (L. Pirozzi).

    E-Print Network [OSTI]

    Artuso, Florinda

    @casaccia.enea.it (L. Pirozzi). Solar Energy Materials & Solar Cells 65 (2001) 287}295 Selective emitters in buried contact silicon solar cells: Some low-cost solutions L. Pirozzi*, G. Arabito, F. Artuso, V. Barbarossa, U cells have prepared and tested. 2001 Elsevier Science B.V. All rights reserved. Keywords: C

  12. * Corresponding author. Tel.: 1-217-333-0417; fax: 1-217-244-1631. E-mail address: arockett@sta!.uiuc.edu (A. Rockett)

    E-Print Network [OSTI]

    Rockett, Angus

    . present address: Global Solar Energy, 5575 South Houghton Rd., Tucson, AZ 85747, USA. Solar Energy Materials & Solar Cells 59 (1999) 255}264 Na incorporation in Mo and CuInSe from production processes A)-based solar cells and modules requires a reproducible deposition process yielding high-quality material

  13. 31Nano-Islands on Plastically Deformed Substrates with Disclinations Corresponding author: I.A. Ovid'ko, e-mail: ovidko@def.ipme.ru

    E-Print Network [OSTI]

    Ovid'ko Ilya A.

    is capable of causing preferable spatial positions of nano-islands. The parameters of the substrate/nano-island systems are theoretically revealed that control spatial positions of nano-islands on disclinated

  14. *Corresponding author. Tel.: 630-252-5672; fax: 630-252-E-mail address: macrander@aps.anl.gov (A.T. Macrander)

    E-Print Network [OSTI]

    Headrick, Randall L.

    by transmission electron microscopy and X-ray di!use scattering A.T. Macrander *, C. Liu , R. Csencsits , R. Cook were DC mag- netron sputtered in the deposition facility of the ad- vanced photon source (APS) [2,3]. 2]. A cross section transmission electron micrograph is shown in Fig. 1. The electron microscopy was done

  15. *Email: kammen@berkeley.edu, Telephone: (510) 642-1640, Fax: (510) 642-1085, Mailing Address: 310 Barrows Hall, University of California, Berkeley, CA 94720, USA

    E-Print Network [OSTI]

    Kammen, Daniel M.

    fuels. Retail electricity rates in the Caribbean average 0.35 US$/kWh (CARILEC, 2010), finding) (Weisser, 2004b). #12;2 Figure 1 Domestic Retail Electricity Rates in Caribbean Islands (CARILEC, 2010, these regions generally rely on imported petroleum for electricity generation. Petroleum products

  16. *Email: kammen@berkeley.edu, Telephone: (510) 642-1640, Fax: (510) 642-1085, Mailing Address: 310 Barrows Hall, University of California, Berkeley, CA 94720, USA

    E-Print Network [OSTI]

    Kammen, Daniel M.

    electricity tariff rates are above 0.35 US$/kWh (CARILEC, 2010), finding themselves amongst the highest rates) (Weisser, 2004b). Figure 1 Domestic Retail Electricity Rates in Caribbean Islands (CARILEC, 2010, these regions generally rely on imported petroleum for electricity generation. The longevity of such energy

  17. *For correspondence. E-mail: tbosch@zoologie.uni.kiel.de; Tel.: +49-431-880-4169; Fax: +49-431-880-4747

    E-Print Network [OSTI]

    of a myriad of microbes including archaea, viruses, and bac- teria (Qin et al., 2010; Human Microbiome Project of animal development and evolution. Keywords: innate immunity, host-microbe interaction, holo- biont, virus forged with microbes have been powerful agents of change. There is now a growing re- alization

  18. E-mail gilles.philippe.paille@gmail.com Website www-etud.iro.umontreal.ca/~paillegp/ University of Montreal, PhD in computer graphics

    E-Print Network [OSTI]

    Montréal, Université de

    for automatic cage construction for non-realistic animation Graduated with honors 2008 ­ 2009 University, software developer Integrated source control systems in their Wwise software Developed programming interfaces for Perforce and Subversion 2006, summer Mistic Software Inc., software developer Developed

  19. from work and goes to her PC to check e-mail, the PC isn't just sitting there. It's working for a biotech company, matching gene

    E-Print Network [OSTI]

    Kubiatowicz, John D.

    for a biotech company, matching gene sequences to a library of protein molecules. Its DSL connection is busy from the biotech company, the movie system and the backup service. Instead of buying expensive "server

  20. * Corresponding author. Tel.: #1-416-946-3019; fax: #1-416-978-E-mail address: rostami@atmosp.physics.utoronto.ca (K. Rostami).

    E-Print Network [OSTI]

    Peltier, W. Richard

    of the global process of glacial isostatic adjustment K. Rostami *, W.R. Peltier , A. Mangini Heidelberg (Peltier, 1998b). In this paper our inten- tion is to provide a similar detailed analysis of this issue