Powered by Deep Web Technologies
Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Data:187059d1-e799-4c86-ab62-1c22cf3c8013 | Open Energy Information  

Open Energy Info (EERE)

e799-4c86-ab62-1c22cf3c8013 e799-4c86-ab62-1c22cf3c8013 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Borough of Kutztown, Pennsylvania (Utility Company) Effective date: 2012/01/01 End date if known: Rate name: INSTITIONAL SERVICE RATE 120000 NON ELECTRIC Sector: Commercial Description: Source or reference: http://www.kutztownboro.org/kutztown/uploads/ElectricRatesJanuary2012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service

2

Data:1eb97ce4-35bb-42e2-8844-13792c86e87e | Open Energy Information  

Open Energy Info (EERE)

5bb-42e2-8844-13792c86e87e 5bb-42e2-8844-13792c86e87e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Slash Pine Elec Member Corp Effective date: End date if known: Rate name: Rate LMS-8 Load Management Service Sector: Commercial Description: Rate LMS-8 Load Management Service Source or reference: ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous

3

Data:47bbc30f-0c8f-4f5c-86ee-4b4837e55251 | Open Energy Information  

Open Energy Info (EERE)

bbc30f-0c8f-4f5c-86ee-4b4837e55251 bbc30f-0c8f-4f5c-86ee-4b4837e55251 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Central Hudson Gas & Elec Corp Effective date: 2012/07/01 End date if known: Rate name: DS-S 150 Watt ( Victorian Gaslight) Sector: Lighting Description: Source or reference: http://www.centralhudson.com/rates/index.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

4

Data:60bbd68c-86f7-400b-a280-156c7c97fedd | Open Energy Information  

Open Energy Info (EERE)

bbd68c-86f7-400b-a280-156c7c97fedd bbd68c-86f7-400b-a280-156c7c97fedd No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Baudette, Minnesota (Utility Company) Effective date: 2011/04/20 End date if known: Rate name: Rate 6 Off Peak Commercial Sector: Commercial Description: Off-peak rates are for winter months only: Sept 21 - June 20. The other time will be calculated using Rate 2 Commercial rates. The monthly fixed charge is a weighted average between the two rates. Source or reference: Rate Binder Kelly 3 ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW):

5

Data:9a107c86-df21-451c-8139-2d87c087c6bb | Open Energy Information  

Open Energy Info (EERE)

7c86-df21-451c-8139-2d87c087c6bb 7c86-df21-451c-8139-2d87c087c6bb No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Edmond, Oklahoma (Utility Company) Effective date: 2009/09/30 End date if known: Rate name: Additional charges-Extension of Secondary Circuit and Wood Pole-45 Sector: Commercial Description: Source or reference: http://edmondok.com/DocumentCenter/Home/View/442 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:

6

Data:2ec69015-6947-44ff-b569-2d9c86b06cea | Open Energy Information  

Open Energy Info (EERE)

5-6947-44ff-b569-2d9c86b06cea 5-6947-44ff-b569-2d9c86b06cea No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Durant, Mississippi (Utility Company) Effective date: 2013/06/21 End date if known: Rate name: AL 11 Sector: Lighting Description: Source or reference: ISU Archive Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous 1 2 3 Next >> Seasonal/Monthly Demand Charge Structures

7

Data:857e7087-0a3c-4c86-bdd7-3392a7e93b29 | Open Energy Information  

Open Energy Info (EERE)

87-0a3c-4c86-bdd7-3392a7e93b29 87-0a3c-4c86-bdd7-3392a7e93b29 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nolin Rural Electric Coop Corp Effective date: 2011/06/01 End date if known: Rate name: Street Lighting: Ornamental Service Overhead 400 Watt HPS Sector: Lighting Description: Source or reference: www.nolinrecc.com Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

8

Data:Dd1e1a9d-dc62-479a-ada5-cd015624c86b | Open Energy Information  

Open Energy Info (EERE)

e1a9d-dc62-479a-ada5-cd015624c86b e1a9d-dc62-479a-ada5-cd015624c86b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northeast Nebraska P P D Effective date: 2013/01/01 End date if known: Rate name: LP2 Large Power Service - Sub-Transmission Substation Sector: Industrial Description: 1.1 This Rate Schedule LP-2 is offered for the entire electrical requirements at a single location of any industrial or manufacturing Customer requiring 5,000 kVa or more of installed transformer capacity, and for which there exists an executed power Purchase Contract between the Customer and the District. Resale of energy taken under this rate schedule by the Customer is not permitted.

9

Data:8d83505b-002e-406c-86fd-ef5c21cfcc9b | Open Energy Information  

Open Energy Info (EERE)

505b-002e-406c-86fd-ef5c21cfcc9b 505b-002e-406c-86fd-ef5c21cfcc9b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Omaha Public Power District Effective date: 2013/01/01 End date if known: Rate name: 115 RESIDENTIAL CONSERVATION SERVICE Sector: Residential Description: To single-family dwellings, farms including only one residential dwelling, trailers, or to each of the units of flats, apartment houses, or multi-family dwellings, when such units are metered individually in the District's Service Area. A "unit" shall be a trailer, apartment, flat, or unit of a multi-family dwelling, equipped with cooking facilities. The single phase, alternating current, electric service will be supplied at the District's standard voltages of 240 volts or less, for residential uses, when all electric service furnished under this Schedule is measured by one meter. This Rate Schedule includes service for air-conditioning motors not exceeding 7 1/2 horsepower each, other motors not exceeding 3 horsepower each; but excludes X-ray and other appliances producing abnormal voltage fluctuations. Not applicable to shared or resale service.

10

Data:88e35c86-394c-466b-af95-77ffb7c0166c | Open Energy Information  

Open Energy Info (EERE)

c86-394c-466b-af95-77ffb7c0166c c86-394c-466b-af95-77ffb7c0166c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Carroll Electric Member Corp Effective date: 2012/02/01 End date if known: Rate name: Outdoor Lighting Underground Wiring Wood Pole HPS 1000 W Sector: Lighting Description: *IDC Rider Charges included in Fixed Monthly Charge $275 one time charge for instillation Source or reference: http://www.cemc.com/Files/OL-2%20Outdoor%20Lighting%20final%202012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh):

11

Data:0ad55bc8-09cd-4c0a-8c50-c86e23acce41 | Open Energy Information  

Open Energy Info (EERE)

bc8-09cd-4c0a-8c50-c86e23acce41 bc8-09cd-4c0a-8c50-c86e23acce41 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Muscoda, Wisconsin (Utility Company) Effective date: 2010/10/26 End date if known: Rate name: Cp-2 Large Power Service with Parallel Generation(20kW or less) Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0844 per kilowatt-hour.

12

Data:E9473217-04c6-4c86-97e2-a67831261362 | Open Energy Information  

Open Energy Info (EERE)

7-04c6-4c86-97e2-a67831261362 7-04c6-4c86-97e2-a67831261362 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cumberland, Wisconsin (Utility Company) Effective date: 2006/03/15 End date if known: Rate name: Ms-1 Street Lighting Service Overhead 175 W MV w/out pole Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0294per kilowatt-hour.

13

Data:3275f978-aee6-4b9f-9ed4-e6bad3c86a1d | Open Energy Information  

Open Energy Info (EERE)

aee6-4b9f-9ed4-e6bad3c86a1d aee6-4b9f-9ed4-e6bad3c86a1d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Reedsburg Utility Comm Effective date: 2011/06/01 End date if known: Rate name: Cp-1 TOD Small Power Optional Time-of-Day Service Primary Metering and Transformer Ownership Discount Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0785 per kilowatt-hour.

14

Data:5280bf35-a79b-4f34-a343-c86d1644d544 | Open Energy Information  

Open Energy Info (EERE)

5-a79b-4f34-a343-c86d1644d544 5-a79b-4f34-a343-c86d1644d544 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cleveland, Ohio (Utility Company) Effective date: End date if known: Rate name: Street Lighting ornamental, 175w mv, 30 ft steel pole Sector: Lighting Description: street lighting,ornamental mercury vapor 175 watt with maximum 75kwh per lamp. Source or reference: http://www.cpp.org/CPP%20RRR%20ORDINANCE%20as%20of%2011-14-06.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months):

15

Data:5747662d-5252-44b9-aad9-9c86e0bdf20b | Open Energy Information  

Open Energy Info (EERE)

62d-5252-44b9-aad9-9c86e0bdf20b 62d-5252-44b9-aad9-9c86e0bdf20b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Pardeeville, Wisconsin (Utility Company) Effective date: 2007/10/10 End date if known: Rate name: Cp-1 Small Power Service Transformer Ownership Discount with Parallel Generation(20kW or less) Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0680 per kilowatt-hour.

16

Data:3fdb68c2-4238-40c6-9138-dc4c86f670a5 | Open Energy Information  

Open Energy Info (EERE)

fdb68c2-4238-40c6-9138-dc4c86f670a5 fdb68c2-4238-40c6-9138-dc4c86f670a5 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Jackson County Rural E M C Effective date: 2011/10/01 End date if known: Rate name: Purchase Offer "R" Sector: Residential Description: Available to any customer on a first-come, first-served basis with on-site distributed generation capacity of 15 kW or less that is powered by renewable resources (e.g. solar, wind, or low-head hydro) and interconnected with Jackson County REMC (REMC) per specifications. Total participation under this tariff is limited to one-tenth of one percent (0.1%) of REMC's peak load during the preceding twelve-month period.

17

Data:451ffc40-8115-466b-a4a4-94f8c86e3c96 | Open Energy Information  

Open Energy Info (EERE)

ffc40-8115-466b-a4a4-94f8c86e3c96 ffc40-8115-466b-a4a4-94f8c86e3c96 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: GreyStone Power Corporation Effective date: 2008/11/01 End date if known: Rate name: Outdoor Lighting Post Top (NLA) MV 100 W Sector: Lighting Description: Additional Charges: Poles and Conductor (a) Overhead Service Length, Facility Rate, Contribution 30 ft. Wood Pole $ 2.25 $ 210 35 ft. Wood Pole $ 2.50 $ 235 40 ft. Wood Pole $ 2.95 $ 275 45 ft. Wood Pole $ 3.30 $ 310 (b) Underground Service Length, Facility Rate, Contribution 30 ft. Wood Pole $ 2.25 $ 210 30& ft. Wood Pole $ 6.25 $ 395

18

Data:A3ab2293-5178-4cb7-95a0-e1e1b4625c86 | Open Energy Information  

Open Energy Info (EERE)

293-5178-4cb7-95a0-e1e1b4625c86 293-5178-4cb7-95a0-e1e1b4625c86 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Princeton, Wisconsin (Utility Company) Effective date: 2006/09/14 End date if known: Rate name: Ms-1 Street Lighting Service Ornamental 150 W HPS Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0524 per kilowatt-hour.

19

PR-PR: Cross-Platform Laboratory Automation System  

Science Journals Connector (OSTI)

Following our previous PR-PR report, it remained to demonstrate PR-PR as a cross-platform laboratory automation system, with support for liquid-handling robotics beyond the Tecan Freedom Evo platform, as well as for entirely distinct device categories including microfluidic devices, human languages (e.g., English), and even non-liquid-handling devices such as automated microscopy systems. ... Here, we report the development and deployment of a web-based software tool, j5, which automates the design of scar-less multipart DNA assembly protocols including SLIC, Gibson, CPEC, and Golden Gate. ...

Gregory Linshiz; Nina Stawski; Garima Goyal; Changhao Bi; Sean Poust; Monica Sharma; Vivek Mutalik; Jay D. Keasling; Nathan J. Hillson

2014-01-09T23:59:59.000Z

20

Data:5aad73b9-a25e-4c86-8322-006a2c4c7784 | Open Energy Information  

Open Energy Info (EERE)

aad73b9-a25e-4c86-8322-006a2c4c7784 aad73b9-a25e-4c86-8322-006a2c4c7784 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Richland, Washington (Utility Company) Effective date: 2013/01/01 End date if known: Rate name: Schedule 70: Security Lighting Area Lighting - Metered 1,000 Watt Mercury Vapor Sector: Lighting Description: A. Availability: In all territory served by the City's electric utility. B. Applicability: To all property owners or long-term leasees of property. C. Contract Provisions: The rates in this schedule apply to facilities consisting of overhead construction with mast arms and luminaries mounted on wood poles with lumen output as shown. Lighting facilities supplied under this schedule shall remain the property of the City, and shall be supplied only pursuant to a contract with the customer, the term of which shall be a period of not less than three (3) years. Pole Rental: When an individual wood pole is required on a new installation, the following monthly charges apply: 40 feet or less $ 1.00 Over 40 feet $ 1.00 plus $0.05 per foot Additional charge will be made for lamps installed seventy-five (75) feet or more above the ground.

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Data:5e8c1abd-cc61-477c-86f8-9f1c78a58de7 | Open Energy Information  

Open Energy Info (EERE)

abd-cc61-477c-86f8-9f1c78a58de7 abd-cc61-477c-86f8-9f1c78a58de7 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Murray, Kentucky (Utility Company) Effective date: 2013/06/01 End date if known: Rate name: Outdoor Lighting- 100W High Pressure Sodium Sector: Lighting Description: Available for service to street and park lighting systems, traffic signal systems, athletic field lighting installations, and outdoor lighting for individual customers. Source or reference: http://www2.murray-ky.net/outdoor_lighting_with_murray_electric_system.html Source Parent: Comments Applicability Demand (kW)

22

Estao Convention Center Curitiba, PR  

E-Print Network [OSTI]

Remoto (Capítulo Brasil) Dra. Leila Maria Garcia Fonseca 1.2 ­ Coordenação da Exposição Técnica Geol. Paulo Roberto Martini ­ SELPER/Brasil ­ Comitê de Relações Internacionais Tel (12) 3208-6470 / 6494 - PR, Brasil Telefax : +55 (41) 2101-9990 Site: www.estacaoconvention.com.br 1.4 - Montadora Oficial

23

Transverse Wobbling in $^{135}$Pr  

E-Print Network [OSTI]

A pair of transverse wobbling bands has been observed in the nucleus $^{135}$Pr. The wobbling is characterized by $\\Delta I$ =1, E2 transitions between the bands, and a decrease in the wobbling energy confirms its transverse nature. Additionally, a transition from transverse wobbling to a three-quasiparticle band comprised of strong magnetic dipole transitions is observed. These observations conform well to results from calculations with the Tilted Axis Cranking (TAC) model and the Quasiparticle Triaxial Rotor (QTR) Model.

Matta, J T; Li, W; Frauendorf, S; Ayangeakaa, A D; Patel, D; Schlax, K W; Palit, R; Saha, S; Sethi, J; Trivedi, T; Ghugre, S S; Raut, R; Sinha, A K; Janssens, R V F; Zhu, S; Carpenter, M P; Lauritsen, T; Seweryniak, D; Chiara, C J; Kondev, F G; Hartley, D J; Petrache, C M; Mukhopadhyay, S; Lakshmi, D Vijaya; Raju, M Kumar; Rao, P V Madhusudhana; Tandel, S K; Ray, S; Dnau, F

2015-01-01T23:59:59.000Z

24

Pr  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

BNL BNL - SM D Page 1/5 BEPC-II Quadrupole and Dipole Double Layer Coil Patterns 5 0 0 0 1 0 0 2 0 0 3 0 0 4 0 0 6 0 0 7 0 0 Z (mm) 300 200 100 0 θ (deg.) 5 0 0 0 1 0 0 2 0 0 3 0 0 4 0 0 Z (mm) 300 200 100 0 θ (deg.) -100 100 -50 50 0 -100 100 -50 50 0 X (mm) Y (mm) SCQ SCB ( HDC) SCQ L coi l = 496 m m L m ag = 400 m m L coi l = 674 m m L m ag = 400 m m Page 2 /5 Z IP (distance from IP, mm) R (mm) 95 6 0 0 1 6 0 0 8 0 0 1 0 0 0 1 2 0 0 1 4 0 0 90 100 105 110 115 120 AS1 AS3 AS2 SCQ SCB (HDC) VDC SKQ Name Layers Conductor SCQ 8 7 strand cable SCB 2 7 strand cable (HDC) VDC 2 1 strand wire SKQ 2 1 strand wire AS1 6 MRI wire AS2 2 MRI wire AS2 6 MRI wire BEPC-II Coil Layout Schematic Page 3 /5 Page 4 /5 Z (cm) R (cm) BES- I I IDet ect or 0 20 60 100 140 180 220 260 300 -1.6 -1.2 -0.8 -0.4 0.0 0.4 0.8 B z on axis (T) AS1 AS2 AS3 (AS2 overlaps SCQ) Z (cm) BES-III Detector and the Three Part Anti-Solenoid Compensation Scheme A S 1-3 are connected i n seri es, but A S 2 & A S 3 have tri m s. Page 5 /5 B, G (T), (T/m) R in , R out

25

Pr  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

BN BN L - SM D Page 1/11 Page 2 /11 B, G (T), (T/m) R in , R out (mm) From IP (mm) Coil Length (mm) Magnetic Length (mm) AS1 - 95.1~105.9 630~933 303 - AS2 - 115.4~119.0 1035~1381 346 - AS3 - 95.1~105.9 1474~1590 116 - SCQ 18.744 95.1~108.1 961~1457 496 400 SCB (HCD) 0.543 0.056 108.5~111.8 633~1307 674 400 VCD 0.059 111.9~113.5 904~1514 610 380 SKQ 0.937 113.6~115.2 954~1464 510 400 Operating Current (A) * ** ** 460 495 (50) 24 45 BEPC-II Magnets 12-May-03 * **AS2 and AS3 are in series with AS1 but can have their own independent trim currents. BEPC-II Superconducting IR Magnet Coil Parameter Summary Z (cm) R (cm) 1 / 2 BES- I I IDet ect orw i t h Ant i - Sol enoi d BEPC-II Anti-Solenoid Design Parameter Summary I m ai n = 1120 A N AS1 = 732 t ur ns N AS2 = 260 t ur ns N AS3 = 280 t ur ns N Tot = 1272 t ur ns L Tot = 78 m H Page 3 /11 Page 4 /11 AS1R AS2R AS3R AS1L AS2L AS3L Left Side Right Side A S 1R A S 2R A S 3R I M ai n ∆I I2R ∆I I3R A S 1L A S 2L A

26

Data:D5eb05e7-4c21-410a-96e7-a1b816c39c86 | Open Energy Information  

Open Energy Info (EERE)

5e7-4c21-410a-96e7-a1b816c39c86 5e7-4c21-410a-96e7-a1b816c39c86 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Salt River Electric Coop Corp Effective date: 2011/06/01 End date if known: Rate name: Underground mercury vapor w/o pole 175 Watts Sector: Lighting Description: Source or reference: www.srelectric.com Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous

27

Data:15fb8a46-8c86-4227-99f4-8f4ac7c61c7f | Open Energy Information  

Open Energy Info (EERE)

fb8a46-8c86-4227-99f4-8f4ac7c61c7f fb8a46-8c86-4227-99f4-8f4ac7c61c7f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Lincoln Electric System Effective date: End date if known: Rate name: Large Light and Power Off-Peak Seasonal Daily Primary Sector: Description: Excess kVA Source or reference: http://www.les.com/your_business/rate_schedules_llp.aspx Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

28

Data:6a8c9c86-b007-441c-b9b5-4f805bd2dfd5 | Open Energy Information  

Open Energy Info (EERE)

c9c86-b007-441c-b9b5-4f805bd2dfd5 c9c86-b007-441c-b9b5-4f805bd2dfd5 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: Customer Generation Under Buy/Sell Concept - Transmission Lines Sector: Industrial Description: To any customer whose requirements are taken at a point or points determined by the District under a contract of standard form, where the customer's total monthly demand load exceeds 20,000 kilowatts and the customer takes delivery on the secondary side of a District Substation on the customer's property. (Not applicable to resale, standby or auxiliary service.)

29

Data:616a6045-2c28-4fe7-95a3-4a1ab14c86c0 | Open Energy Information  

Open Energy Info (EERE)

045-2c28-4fe7-95a3-4a1ab14c86c0 045-2c28-4fe7-95a3-4a1ab14c86c0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Cornhusker Public Power Dist Effective date: 2012/01/01 End date if known: Rate name: Irrigation and Grain-Drying Service I-4 (17, 18)- Seven Control Days - With Capacitor Sector: Residential Description: Source or reference: Illinois State University Binder #10 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:

30

Data:D12e81a4-0c87-4c86-a8a8-49b5d633be10 | Open Energy Information  

Open Energy Info (EERE)

e81a4-0c87-4c86-a8a8-49b5d633be10 e81a4-0c87-4c86-a8a8-49b5d633be10 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of River Falls, Wisconsin (Utility Company) Effective date: 2008/04/11 End date if known: Rate name: Ms-2 Area Lighting Service 150 Watt High Pressure Sodium Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0662 per kilowatt-hour.

31

pr esent ee par Pascal Brand  

E-Print Network [OSTI]

TH#12;ESE pr esent ee par Pascal Brand pour obtenir le grade de Docteur de l'Universit e Claude Giraudon Examinateurs: M. Serge Castan M. Roger Mohr Th#12;ese pr epar ee au sein du laboratoire Lifia Imag de coins dans l'image : : : : : : : : : : : : : : : : : : : 31 2.1.3 Extraction de cibles circulaires

Paris-Sud XI, Université de

32

Nome Tipo Localidade de prova ALISSON FRANCISCO KRUL INGRESSANTE CURITIBA -PR  

E-Print Network [OSTI]

DOS SANTOS INGRESSANTE CURITIBA - PR RENAN LUIZ DOS SANTOS INGRESSANTE CURITIBA - PR RICARDO BRANDT MEISTER INGRESSANTE CURITIBA - PR RODRIGO FELIX DE ALMEIDA INGRESSANTE CURITIBA - PR TANIA MIKA MIYAZAWA

Paraná, Universidade Federal do

33

OP-PR-0010-001.PDF  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

OP-PR-0010-001.doc Student Caretaker Date: 20000830 1. Assure that your name appears on the "Student Caretaker Authorization List" (OP-AL-0010-001.doc). 2. Place your name,...

34

Complexo Rafain Expocenter Foz do Iguau, PR  

E-Print Network [OSTI]

Brasil - Associação de Especialistas Latinoamericanos em Sensoriamento Remoto Dr. Laércio Massuru Namikawa 1.2 Coordenação da Exposição Técnica Geol. Paulo Roberto Martini ­ SELPER Brasil Tel: +55 (12 CEP: 85862-210 ­ Foz do Iguaçu, PR ­ Brasil Tel: +55 (45) 3520-9494 Site: www.rafainpalace.com.br 1

35

acs_PR_pr-2011-00851y 1..12  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

pr200851y pr200851y | J. Proteome Res. XXXX, XXX, 000-000 ARTICLE pubs.acs.org/jpr Defining the Boundaries and Characterizing the Landscape of Functional Genome Expression in Vascular Tissues of Populus using Shotgun Proteomics Paul Abraham, †,‡,§ Rachel Adams, †,‡,§ Richard J. Giannone, ‡ Udaya Kalluri, || Priya Ranjan, || Brian Erickson, ‡ Manesh Shah, ‡ Gerald A. Tuskan, || and Robert L. Hettich* ,‡ ) Biosciences Division and ‡ Chemical Sciences Division at Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831, United States § Graduate School of Genome Science and Technology, University of Tennessee, Knoxville, Tennessee 37830, United States b S Supporting Information ' INTRODUCTION The advent of high-throughput DNA sequencing has revolutio- nized the assembly of high-quality genomes for prokaryotes and eukaryotes such as plants and humans. 1 The

36

acs_PR_pr-2011-00536j 1..13  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

1, 1, 2011 r 2011 American Chemical Society 5302 dx.doi.org/10.1021/pr200536j | J. Proteome Res. 2011, 10, 5302-5314 ARTICLE pubs.acs.org/jpr Label-free Quantitative Proteomics for the Extremely Thermophilic Bacterium Caldicellulosiruptor obsidiansis Reveal Distinct Abundance Patterns upon Growth on Cellobiose, Crystalline Cellulose, and Switchgrass Adriane Lochner, †,‡,§,|| Richard J. Giannone, ‡,||,^ Martin Keller, †,‡ Garabed Antranikian, § David E. Graham,* ,†,# and Robert L. Hettich* ,‡,^ † Biosciences Division; ^ Chemical Sciences Division; ‡ BioEnergy Science Center at Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831, United States § Technical Microbiology, Hamburg University of Technology, Kasernenstrasse 12, D-21073 Hamburg, Germany # Department of Microbiology, University of Tennessee, Knoxville, Tennessee 37996,

37

http://www.careerplayer.com/graduate-jobs/advertising-and-pr/pr/consumer-and-b2b-http://www.careerplayer.com/graduate-jobs/marketing-and-  

E-Print Network [OSTI]

/graduate-jobs/advertising-and-pr/pr/consumer-and-b2b- pr/lydia/ MARKETING http://www.careerplayer.com/graduate-jobs/marketing-and- sales/marketing/marketing-and-brand-management/florence-symington/ http://www.careerplayer.com/graduate-jobs/marketing-and- sales/marketing/marketing-and-brand-management/john-beasley-marketing://www.careerplayer.com/graduate-jobs/travelleisurehospitality/events/event- management/mick-lindsay/1 #12;Department Marketing, PR & Event Management: CV and Applications February 2014

Sheldon, Nathan D.

38

Thank YouPrESIDENT'S Alfred P Sloan Foundation  

E-Print Network [OSTI]

Thank YouPrESIDENT'S CIrCLE $100,000+ Alfred P Sloan Foundation ConocoPhillips Canada ASSINIBo Industries Inc. · Alzheimer Society of Canada · Andy Liu · Branch Out Neurological Foundation · Canadian of Violet Lesia Starck · George Castles · Google Inc. · Heart & Stroke Foundation of Alberta, NWT & Nunavut

Machel, Hans

39

STANFORD GEOTHERMAL PR0GRAh.I STANFORD UNIVERSITY  

E-Print Network [OSTI]

Department of Energy since 1975. research i n geothermal r e s e r v o i r engineering techniques t h a t w iSTANFORD GEOTHERMAL PR0GRAh.I STANFORD UNIVERSITY STANFORD,CALIFORNIA 94305 SGP-TR-5 1 GEOTHERMAL Implications of Adsorption and Formation Fluid Composition on Geothermal Reservoir Evaluation . . 40 TASK 5

Stanford University

40

CCFE-PR(13)44 Beyond ITER: Neutral beams  

E-Print Network [OSTI]

R. McAdams CCFE-PR(13)44 Beyond ITER: Neutral beams for DEMO #12;Enquiries about copyright Kingdom Atomic Energy Authority is the copyright holder. #12;Beyond ITER: Neutral beams for DEMO R. Mc ITER: Neutral beams for DEMOa) R. McAdamsb) EURATOM/CCFE Association, Culham Science Centre, Abingdon

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

E-Print Network 3.0 - antonina pr brasil Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

pr brasil Search Powered by Explorit Topic List Advanced Search Sample search results for: antonina pr brasil Page: << < 1 2 3 4 5 > >> 1 Accepted by C. Schaefer: 19 Apr. 2005;...

42

Instructions for use PHYSICAL REVIEW C 86, 064604 (2012)  

E-Print Network [OSTI]

reactions in the low relative energy region are of a great interest from the astrophysics point of view, because the radiactive capture reactions at very low energies (Ecm 10­100 keV) are one of the key nuclear data are required for n- and p-induced reactions. Indeed, the International Atomic Energy Agency

Tsunogai, Urumu

43

RECORD OF CATEGORICAL EXCLUSION DETERMINATION Project ID No. PR-10084713  

Broader source: Energy.gov (indexed) [DOE]

PR-10084713 PR-10084713 Title: Purchase of BH Control Valve Assembly Description: Vendor shall supply and deliver one 16-inch, 600# Control Valve Assembly to the Big Hill SPR site. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following: (1) The proposed action fits within a class of actions that is listed in Appendix A or B of Subpart D; (2) There are no extraordinary circumstances related to the proposal that may affect the

44

Glass Forming Ability in Pr-(Cu, Ni)-Al Alloys  

E-Print Network [OSTI]

Glass forming ability (GFA) in the Pr-rich Pr-(Cu, Ni)-Al alloys at or near the eutectic points was systematically studied. It was found that the GFA in the pseudo-ternary alloys of Pr-(Cu, Ni)-Al is higher than that of ...

Zhang, Yong

45

Generation IV PR and PP Methods and Applications  

SciTech Connect (OSTI)

This paper presents an evaluation methodology for proliferation resistance and physical protection (PR&PP) of Generation IV nuclear energy systems (NESs). For a proposed NES design, the methodology defines a set of challenges, analyzes system response to these challenges, and assesses outcomes. The challenges to the NES are the threats posed by potential actors (proliferant States or sub-national adversaries). The characteristics of Generation IV systems, both technical and institutional, are used to evaluate the response of the system and determine its resistance against proliferation threats and robustness against sabotage and terrorism threats. The outcomes of the system response are expressed in terms of six measures for PR and three measures for PP, which are the high-level PR&PP characteristics of the NES. The methodology is organized to allow evaluations to be performed at the earliest stages of system design and to become more detailed and more representative as design progresses. Uncertainty of results are recognized and incorporated into the evaluation at all stages. The results are intended for three types of users: system designers, program policy makers, and external stakeholders. Particular current relevant activities will be discussed in this regard. The methodology has been illustrated in a series of demonstration and case studies and these will be summarized in the paper.

Bari,R.A.

2008-10-13T23:59:59.000Z

46

PR B_WY_C BM HILIGHT POWELL KIT TY WELL D RAW SC OT T MIKES D  

U.S. Energy Information Administration (EIA) Indexed Site

Gas Reserve Class Gas Reserve Class No 2001 gas reserves 0.1 - 10 MMCF 10.1 - 100 MMCF 100.1 - 1,000 MMCF 1,000.1 - 10,000 MMCF 10,000.1 - 100,000 MMCF > 100,000 MMCF Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas,

47

PR B_WY_C BM HILIGHT POWELL KIT TY WELL D RAW SC OT T MIKES D  

U.S. Energy Information Administration (EIA) Indexed Site

Liquids Reserve Class Liquids Reserve Class No 2001 liquids reserves 0.1 - 10 Mbbl 10.1 - 100 Mbbl 100.1 - 1,000 Mbbl 1,000.1 - 10,000 Mbbl 10,000.1 - 100,000 Mbbl Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas, Energy Information Administration pursuant to studies required by

48

PR B_WY_C BM HILIGHT POWELL KIT TY WELL D RAW SC OT T MIKES D  

U.S. Energy Information Administration (EIA) Indexed Site

BOE Reserve Class BOE Reserve Class No 2001 reserves 0.1 - 10 MBOE 10.1 - 100 MBOE 100.1 - 1,000 MBOE 1,000.1 - 10,000 MBOE 10,000.1 - 100,000 MBOE > 100,000 MBOE Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas,

49

Lattice and magnetic structures of PrFeAsO, PrFeAsO0.85F0.15, and PrFeAsO0.85  

SciTech Connect (OSTI)

We use powder neutron diffraction to study the spin and lattice structures of polycrystalline samples of nonsuperconducting PrFeAsO and superconducting PrFeAsO0.85F0.15 and PrFeAsO0.85. We find that PrFeAsO exhibits abrupt structural phase transitions at 153 K followed by static long-range antiferromagnetic order at 127 K. Both the structural distortion and magnetic order are similar to other rare-earth oxypnictides. Electron doping the system with either fluorine or oxygen deficiency suppresses the structural distortion and static long-range antiferromagnetic order, therefore placing these materials into the same class of FeAs-based superconductors.

Zhao, Jun [University of Tennessee, Knoxville (UTK); Huang, Q. [National Institute of Standards and Technology (NIST); de la Cruz, Clarina [University of Tennessee, Knoxville (UTK) & Oak Ridge National Laboratory (ORNL); Haraldsen, J. T. [University of Tennessee, Knoxville (UTK); Lynn, J. W. [National Institute of Standards and Technology (NIST); Lumsden, Mark D [ORNL; Ren, Z A [National Laboratory for Superconductivity, Beijing; Yang, Jie [Beijing National Laboratory for Condensed Matter Physics/Chinese Academy of Scie; Shen, Xiaolin [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics; Dong, Xiaoli [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics; Zhao, Zhongxian [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics; Dai, Pengcheng [University of Tennessee, Knoxville (UTK)

2008-01-01T23:59:59.000Z

50

Lattice and magnetic structures of PrFeAsO, PrFeAsO{sub 0.85}F{sub 0.15}, and PrFeAsO{sub 0.85}  

SciTech Connect (OSTI)

We use powder neutron diffraction to study the spin and lattice structures of polycrystalline samples of nonsuperconducting PrFeAsO and superconducting PrFeAsO{sub 0.85}F{sub 0.15} and PrFeAsO{sub 0.85}. We find that PrFeAsO exhibits abrupt structural phase transitions at 153 K followed by static long-range antiferromagnetic order at 127 K. Both the structural distortion and magnetic order are similar to other rare-earth oxypnictides. Electron doping the system with either fluorine or oxygen deficiency suppresses the structural distortion and static long-range antiferromagnetic order, therefore placing these materials into the same class of FeAs-based superconductors.

Zhao Jun [Department of Physics and Astronomy, The University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Huang, Q.; Lynn, J. W. [NIST Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-6012 (United States); Cruz, Clarina de la; Dai Pengcheng [Department of Physics and Astronomy, The University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Neutron Scattering Science Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Lumsden, M. D. [Neutron Scattering Science Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States); Ren, Z. A.; Yang Jie; Shen Xiaolin; Dong Xiaoli; Zhao Zhongxian [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100080 (China)

2008-10-01T23:59:59.000Z

51

Silicate layer formation at Pr{sub 2}O{sub 3}/Si(001) interfaces  

SciTech Connect (OSTI)

We studied Pr{sub 2}O{sub 3}/Si(001) interfaces by synchrotron radiation photoelectron spectroscopy and by ab initio calculations. We show that the interface formed during molecular-beam epitaxy under the oxygen partial pressure above 1x10{sup -8} mbar consists of a mixed Si-Pr oxide, such as (Pr{sub 2}O{sub 3})(SiO){sub x}(SiO{sub 2}){sub y}. Neither an interfacial SiO{sub 2} nor an interfacial silicide is formed. The silicate formation is driven by a low energy of O in a PrOSi bond and by the strain in the subsurface SiO{sub x} layer. We expect that this natural interfacial Pr silicate will facilitate the integration of the high-k dielectric Pr{sub 2}O{sub 3} into future complementary metal-oxide-semiconductor technologies.

Schmeisser, D.; Muessig, H.-J.; Dabrowski, J. [Angewandte Physik-Sensorik, BTU Cottbus, Postfach 10 13 44, D-03013 Cottbus (Germany); IHP, Im Technologiepark 25, D-15236 Frankfurt (Germany)

2004-07-05T23:59:59.000Z

52

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

'eduisons une estimation asymptotique du temps de retour du flot g'eod'esique pr`es de P , et de la loi de la dur'ee d'une excursion du * *flot g'eod'esique pr`es de P . Dans le cas particulier des orbifolds asymptotique de l'homologie d'une excursion du flot g'eod'esique pr`es de P . 1 Introduction Les vari

Université Pierre-et-Marie-Curie, Paris 6

53

Porous Pr(OH)3 Nanostructures as High-Efficient Adsorbents for Dye Removal  

Science Journals Connector (OSTI)

Herein, we report the electrochemical synthesis of porous Pr(OH)3 nanobelt arrays (NBAs), nanowire arrays (NWAs), nanowire bundles (NWBs), nanowires (NWs) and their applications as dye...

zhai, teng; Lu, Xihong; Yu, Minghao; Xie, Shilei; Tong, Yexiang

54

Mk12A/W78 ground test project (u)  

SciTech Connect (OSTI)

The slides present the scope, objectives and status of the Mk12A1W78 Ground Test Project for the purpose of updating the ICBM Project Officers Group. In addition, project constraints and risks are discussed.

Stokes, Kyle R [Los Alamos National Laboratory

2010-12-01T23:59:59.000Z

55

Effect of hydrogenation on magnetic and electronic behaviour of Pr-Ni  

SciTech Connect (OSTI)

Magnetic and electronic properties of PrNi and PrNi-H have been investigated by using first principles approach. The ground state of both the compounds is base-centered orthorhombic CrB structure. Calculations are performed using full potential linearized augmented plane wave plus local orbitals (FP-L/APW) method including spin-polarization within the frame work of density functional theory (DFT). The electronic exchange-correlation energy is described by generalized gradient approximation (GGA). The hydrogen stored in PrNi, i.e., PrNi-H has been studied to analyze the effective changes in magnetic moments and electronic structures in comparison to PrNi. A comparative study of the density of states in both the compounds has also been presented.

Rana, Pooja, E-mail: poojafizix@yahoo.com; Singh, Sanjay K., E-mail: poojafizix@yahoo.com; Verma, U. P., E-mail: poojafizix@yahoo.com [School of Studies in Physics, Jiwaji University, Gwalior-474011 (India)

2014-04-24T23:59:59.000Z

56

Inelastic neutron scttering study o fcrystal field levels in PrOs4As12  

SciTech Connect (OSTI)

We use neutron scattering to study the Pr$^{3+}$ crystalline electric field (CEF) excitations in the filled skutterudite PrOs$_4$As$_{12}$. By comparing the observed levels and their strengths under neutron excitation with the theoretical spectrum and neutron excitation intensities, we identify the Pr$^{3+}$ CEF levels, and show that the ground state is a magnetic $\\Gamma_4^{(2)}$ triplet, and the excited states $\\Gamma_1$, $\\Gamma_4^{(1)}$ and $\\Gamma_{23}$ are at 0.4, 13 and 23~meV, respectively. A comparison of the observed CEF levels in PrOs$_4$As$_{12}$ with the heavy fermion superconductor PrOs$_4$Sb$_{12}$ reveals the microscopic origin of the differences in the ground states of these two filled skutterudites.

Chi, Songxue [ORNL; Dai, Pengcheng [ORNL; Barnes, Ted {F E } [ORNL; Kang, H. J. [National Institute of Standards and Technology (NIST); Lynn, J. W. [National Institute of Standards and Technology (NIST); Ye, Feng [ORNL; Maple, M. B. [University of California, San Diego

2008-01-01T23:59:59.000Z

57

Mechanism of Action and Preclinical Antitumor Activity of the Novel Hypoxia-Activated DNA Cross-Linking Agent PR-104  

Science Journals Connector (OSTI)

...hypoxia (10 ppm O2 gas phase), PR-104...as para to the nitrogen mustard. PR-104H...limited aqueous solubility (1.66 mmol...medium); a water-soluble phosphate...gave an aqueous solubility of 200 mmol...study describes a nitrogen mustard pre-prodrug...PR-104 itself is a water-soluble phosphate...

Adam V. Patterson; Dianne M. Ferry; Shelley J. Edmunds; Yongchuan Gu; Rachelle S. Singleton; Kashyap Patel; Susan M. Pullen; Kevin O. Hicks; Sophie P. Syddall; Graham J. Atwell; Shangjin Yang; William A. Denny; and William R. Wilson

2007-07-01T23:59:59.000Z

58

Radio-frequency-induced optical gain in Pr3+:Y2SiO5  

Science Journals Connector (OSTI)

We report an observation of radio-frequency (RF)-induced transparency in an optically dense medium of Pr3+-doped Y2SiO5. We observed that the optical...

Ham, B S; Shahriar, M S; Hemmer, P R

1998-01-01T23:59:59.000Z

59

Neutron scattering study on f-electron states in PrCu4Au  

SciTech Connect (OSTI)

Neutron scattering studies were carried out for investigating heavy-electron-like behaviors of PrCu4Au. Excitation spectra are composed of crystal-field (CF) excitations in the Pr3+4f2 electron configuration and a broad component. The CF splitting ground state is a triplet 5. The type-II antiferromagnetic ordering characterized by the propagation vector (1/2, 1/2, 1/2) appears below approximately 4 K. The powder diffraction pattern is reproduced by the ordered magnetic moments aligning along the direction perpendicular to the propagation vector. The magnitude of the ordered magnetic moment is evaluated as 1.36uB/Pr, which is less than 2.0uB/Pr expected from the 5 ground state. Dual electronic states of both localized and itinerant character are inferred.

Iwasa, Kazuaki [Tohoku University, Japan; Kobayashi, Hiroki [Tohoku University, Japan; Saito, Kotaro [Tohoku University, Japan; Tomiyasu, Dr. Keisuke [Tohoku University, Japan; Zhang, Shuai [Hiroshima University, Japan; Isikawa, Yosikazu [Toyama University, Japan; Mignot, Jean-Michel [Laboratoire Leon Brillouin, France; Andre, G. [Laboratoire Leon Brillouin, France; Kawana, Kaichi [KEK, Tsukuba, Ibaraki, Japan; Kolesnikov, Alexander I [ORNL; Savici, Andrei T [ORNL; Granroth, Garrett E [ORNL

2014-01-01T23:59:59.000Z

60

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

'eduisons l'asymptotique du temps de retour du flot g'eod'esique pr`es de P et la loi asymptotique d'une excursion normalis'ee pr`es de P . 1 Introduction Les vari'et'es hyperboliques et leur flot g'eod le flot g'eod'esique, finie, mais * *elle est tr`es singuli`ere par rapport `a la mesure de

Université Pierre-et-Marie-Curie, Paris 6

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Rare earth focused ion beam implantation utilizing Er and Pr liquid alloy ion sources  

E-Print Network [OSTI]

Pr,10,11 Eu,12 Dy,13 Er,13­15 and Tm16 doped GaN. Rare earth elements were added during growthRare earth focused ion beam implantation utilizing Er and Pr liquid alloy ion sources L. C. Chao, B write implantation. © 1999 American Vacuum Society. S0734-211X 99 08306-7 I. INTRODUCTION Rare earth

Steckl, Andrew J.

62

Two-step quantum cutting efficiency in Pr3+-Yb3+ codoped KY3F10  

Science Journals Connector (OSTI)

The efficiency of a two-step quantum cutting (QC) mechanism for solar downconversion via two consecutive energy transfers from Pr3+ to Yb3+ is investigated in Pr3+-Yb3+ codoped KY3F10 crystals. The efficiency of the QC second energy transfer involving the Pr3+ (1G4) and Yb3+ (2F5/2) levels is particularly difficult to determine in a precise manner since these two levels are coupled by reciprocal energy transfer. We present a specific rate equation modeling that accurately describes Pr3+ and Yb3+ dynamics and intensity ratios measured as a function of the Yb3+ concentration. The modeling enables to calculate energy transfer rates for all the processes and shows the competition between the two-step QC mechanism and parasitic processes. The first-step of the QC mechanism is, as expected, particularly efficient reaching 96.9% and is not challenged by competing processes. The second step of the QC, while reaching an intrinsic efficiency of 75.9%, is plagued by backtransfers from Yb3+ (2F5/2) to Pr3+ (1G4) along with efficient concentration quenching mechanisms draining the Yb3+ excited-state. In addition, the investigation of intensity ratios with the Yb3+ concentration shows the importance of energy migration among Yb3+ ions that further enhances the detrimental effect of the Yb3+ quenching processes. As a result, the intrinsic QC efficiency (QCE) of the QC first and second energy transfers increases with the Yb3+ doping level up to 173% in KY3F10: 0.5%Pr3+-20%Yb3+, while the real QCE reduced by migration-assisted quenching processes is only 6.2% in this sample. These results clarify apparently conflicting reports found in the literature showing, on one hand, very high QCEs derived from spectroscopic experiments and, on the other hand, very low efficiency values obtained from integrating sphere measurements.

D. Serrano; A. Braud; J. L. Doualan; W. Bolaos; R. Moncorg; P. Camy

2013-11-27T23:59:59.000Z

63

Underwater Explosive Shock Consolidation of Nanocomposite Pr2Fe14B/-Fe Magnetic Powders  

E-Print Network [OSTI]

performance permanent magnets has focused attention on exchange-coupled nanocomposites because of their low to fabricate exchange-coupled Pr2Fe14B/-Fe nanocomposite bulk magnets, using explosively generated shock waves, ensured exchange coupling between the hard and soft phases, resulting in magnetic properties better than

Liu, J. Ping

64

Explosive shock processing of Pr2Fe14B/ Fe exchange-coupled nanocomposite bulk magnets  

E-Print Network [OSTI]

Explosive shock processing of Pr2Fe14B/ ­Fe exchange-coupled nanocomposite bulk magnets Z.Q. Jin between neigh- boring magnetic phases.1,2 The prerequisite for effective exchange coupling is a small are usually used to produce single-phase microcrystalline permanent magnets, are not favored in making bulk

Liu, J. Ping

65

Prediction of Solid Polycyclic Aromatic Hydrocarbons Solubility in Water with the NRTL-PR Model  

E-Print Network [OSTI]

processes of PAH with subcritical water [5,6] since it provides the extractability limit which can be used groups, for the representation of the solubility of solid PAH in subcritical water. These hal-00872639Prediction of Solid Polycyclic Aromatic Hydrocarbons Solubility in Water with the NRTL-PR Model

Paris-Sud XI, Université de

66

Cytosolic PrP Can Participate in Prion-Mediated Toxicity  

E-Print Network [OSTI]

-PAGE and western blot to detect 242 PrP. 243 244 SDS-PAGE and western blot 245 Fly head homogenate was mixed with an equal volume of x2-strength Laemmli loading 246 buffer, boiled for 10 minutes, cooled on ice and then centrifuged at 13,000 X g for 5 minutes 247...

Thackray, Alana; Zhang, Chang; Arndt, Tina; Bujdoso, Raymond

2014-05-07T23:59:59.000Z

67

Manfred Braune, PrEng, GBCSA Technical Executive 7 December 2011  

E-Print Network [OSTI]

Manfred Braune, PrEng, GBCSA Technical Executive 7 December 2011 Status of Green Building in South compulsory standard for sustainable development is nationally required and implemented by all ­ these must forward Green Building best practice No.ofbuildings Top 25%of Green building best practice Illegal Leaders

68

Beta decay energies and nuclear masses of148Ba,148La and151Pr  

Science Journals Connector (OSTI)

The?-decay energy of the neutron-rich isotopes148Ba,148La and151Pr has been measured at the Institute Laue-Langevin (ILL). The148Ba- and148La-nuclei were produced using a high-temperature ion source at the OSTIS ...

M. Graefenstedt; P. Jrgens; U. Keyser

1990-01-01T23:59:59.000Z

69

Pr ufung aus Compilerbau am 20. Juni 1997 Name: Studienkz. Matrikelnummer  

E-Print Network [OSTI]

Pkt Note: Notenschl¨ ussel: Note Punkte 1 60 -- 66 2 51 -- 59 3 42 -- 50 4 33 -- 41 5 0 -- 32 . #12; Pr¨ ufung aus Compilerbau, 20. Juni 1997 1 1. Lexikalische Analyse. In ANSI C sind Integer

70

Chiral RKKY interaction in Pr[subscript 2]Ir[subscript 2]O[subscript 7  

E-Print Network [OSTI]

Motivated by the potential chiral spin liquid in the metallic spin ice Pr[subscript 2]Ir[subscript 2]O[subscript 7], we consider how such a chiral state might be selected from the spin-ice manifold. We propose that chiral ...

Flint, Rebecca

71

Crystal structure and magnetic properties of Pr- and Ti-substituted La{sub 2}RuO{sub 5}  

SciTech Connect (OSTI)

Highlights: Synthesis of polycrystalline Pr and Ti co-substituted La{sub 2}RuO{sub 5} with soft chemistry. Investigation of structureproperty relationship of the dimerization transition. Additive behavior of structural changes caused by either Pr or Ti substitution. Additive behavior of ht-phase paramagnetism of Pr and Ti substitution. Additive influence of Pr and Ti substitution on the dimerization transition. - Abstract: Polycrystalline samples of Pr- and Ti-substituted La{sub 2}RuO{sub 5} were prepared applying a soft-chemistry route based on the thermal decomposition of citrate-stabilized precursors. The simultaneous substitution on the La-sites by Pr and on the Ru-sites by Ti results in samples of the composition La{sub 2?x}Pr{sub x}Ru{sub 1?y}Ti{sub y}O{sub 5} with 0 ? x ? 0.75 and 0 ? y ? 0.4. The crystal structures of these compounds were analyzed by Rietveld refinement of powder X-ray diffraction patterns. For pure La{sub 2}RuO{sub 5} a structural transition from a monoclinic room-temperature modification to a triclinic low-temperature structure was found at 161 K. This structural change is linked to a low-temperature long-range ordered spin-singlet ground state formed by Ru{sup 4+} spin-moments. Both the structural transition and the formation of the singlet ground state become progressively suppressed with higher Ti contents, while the Pr substitution has only a minor influence on the dimerization. The behavior of the CurieWeiss temperatures can be explained assuming two almost independent magnetic sublattices corresponding to the ruthenium and the rare-earth ions, respectively. For all investigated properties, i.e. crystal structure, magnetic susceptibilities, and dimerization temperature T{sub d}, a completely additive behavior of the effects of Pr-substitution and Ti-substitution is observed.

Riegg, S., E-mail: stefan.riegg@physik.uni-augsburg.de [Experimental Physics V, Center for Electronic Correlations and Magnetism, University of Augsburg, D-86159 Augsburg (Germany); Loidl, A. [Experimental Physics V, Center for Electronic Correlations and Magnetism, University of Augsburg, D-86159 Augsburg (Germany); Reller, A. [Resource Strategy, University of Augsburg, D-86159 Augsburg (Germany); Ebbinghaus, S.G. [Solid State Chemistry, Martin-Luther University Halle-Wittenberg, D-06099 Halle (Germany)

2013-11-15T23:59:59.000Z

72

Magnetic susceptibility of PrMg3 at ultra low temperatures  

Science Journals Connector (OSTI)

We report susceptibility measurements of PrMg3 with a non-magnetic T3 crystalline-electric-field ground state down to 0.3 mK. The susceptibility shows the Van-Vleck-like behavior with an additional logarithmic temperature dependence below 10 K. Furthermore, the susceptibility exhibits a small peak around 0.1 K, which is attributed to the quenching of the multipole degrees of freedom. Below 30 mK, the susceptibility is almost constant down to the lowest temperature without showing the contribution of Pr nuclear spins. The disappearance of nuclear spin contribution suggests that the quenching of the multipole degrees of freedom strongly affects the nuclear spin system.

J Yoshida; S Abe; A Tada; H Tsujii; K Matsumoto; H Suzuki; H S Suzuki

2009-01-01T23:59:59.000Z

73

UNIVERSIDADE FEDERAL DO PARAN PR-REITORIA DE PESQUISA E PS-GRADUAO  

E-Print Network [OSTI]

DE P?S-GRADUA??O LATO SENSU (ESPECIALIZA??O) Rua XV de Novembro, 1299 - Sobreloja ­ Centro - CEP 80.060-000 - Curitiba ­ PR - Fone: 3360 5121 Página 1 de 11 PRPPG/Lato Sensu: Rua Dr. Faivre, 405, Ed. Dom Pedro II, 1º andar - CEP: 80060-140 ­ Fone: 3360 5329 FUNPAR: Rua João Negrão, 280 ­ Fone: 3360 7400 ROTEIRO PARA

Paraná, Universidade Federal do

74

Process hazards analysis (PrHA) program, bridging accident analyses and operational safety  

SciTech Connect (OSTI)

Recently the Final Safety Analysis Report (FSAR) for the Plutonium Facility at Los Alamos National Laboratory, Technical Area 55 (TA-55) was revised and submitted to the US. Department of Energy (DOE). As a part of this effort, over seventy Process Hazards Analyses (PrHAs) were written and/or revised over the six years prior to the FSAR revision. TA-55 is a research, development, and production nuclear facility that primarily supports US. defense and space programs. Nuclear fuels and material research; material recovery, refining and analyses; and the casting, machining and fabrication of plutonium components are some of the activities conducted at TA-35. These operations involve a wide variety of industrial, chemical and nuclear hazards. Operational personnel along with safety analysts work as a team to prepare the PrHA. PrHAs describe the process; identi fy the hazards; and analyze hazards including determining hazard scenarios, their likelihood, and consequences. In addition, the interaction of the process to facility systems, structures and operational specific protective features are part of the PrHA. This information is rolled-up to determine bounding accidents and mitigating systems and structures. Further detailed accident analysis is performed for the bounding accidents and included in the FSAR. The FSAR is part of the Documented Safety Analysis (DSA) that defines the safety envelope for all facility operations in order to protect the worker, the public, and the environment. The DSA is in compliance with the US. Code of Federal Regulations, 10 CFR 830, Nuclear Safety Management and is approved by DOE. The DSA sets forth the bounding conditions necessary for the safe operation for the facility and is essentially a 'license to operate.' Safely of day-to-day operations is based on Hazard Control Plans (HCPs). Hazards are initially identified in the PrI-IA for the specific operation and act as input to the HCP. Specific protective features important to worker safety are incorporated so the worker can readily identify the safety parameters of the their work. System safety tools such as Preliminary Hazard Analysis, What-If Analysis, Hazard and Operability Analysis as well as other techniques as necessary provide the groundwork for both determining bounding conditions for facility safety, operational safety, and day-to-clay worker safety.

Richardson, J. A. (Jeanne A.); McKernan, S. A. (Stuart A.); Vigil, M. J. (Michael J.)

2003-01-01T23:59:59.000Z

75

Appendix B: CArBon dioxide CApture teChnology SheetS Oxygen PrOductiOn  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Oxygen PrOductiOn Oxygen PrOductiOn B-500 Oxygen PrOductiOn u.S. dePartment Of energy advanced carbOn diOxide caPture r&d PrOgram: technOlOgy uPdate, may 2013 itm Oxygen technOlOgy fOr integratiOn in igcc and Other advanced POwer generatiOn SyStemS primary project goals Air Products and Chemicals set out to design and develop an ion transport membrane (ITM) based on ceramics that selectively transport oxygen (O 2 ) ions when operated at high temperature. This high-temperature process may be integrated with advanced power genera- tion processes that require O 2 as a feedstock, such as integrated gasification combined cycle (IGCC) and other clean energy and industrial applications. technical goals * Design, construct, and operate a 0.1-ton/day (TPD) technology development unit

76

Comparison of Rainfall Profiles in the West African Monsoon as Depicted by TRMM PR and the LMDZ Climate Model  

Science Journals Connector (OSTI)

Vertical rainfall profiles obtained with TRMM-PR 2A25 standard products are compared with rain profiles deduced from the Laboratoire de Mtorologie Dynamique second generation global climate model (LMDZ, the Z stands for zoom capability) with ...

Samo Diatta; Frdric Hourdin; Amadou Thierno Gaye; Nicolas Viltard

2010-05-01T23:59:59.000Z

77

TimeSpace Characteristics of Diurnal Rainfall over Borneo and Surrounding Oceans as Observed by TRMM-PR  

Science Journals Connector (OSTI)

Five years of Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR) data were used to investigate the time and space characteristics of the diurnal cycle of rainfall over and around Borneo, an island in the Maritime Continent. The ...

Hiroki Ichikawa; Tetsuzo Yasunari

2006-04-01T23:59:59.000Z

78

Experimental and Computational Studies of Binding of Dinitrogen, Nitriles, Azides, Diazoalkanes, Pyridine and Pyrazines to M(PR3)2(CO)3 (M=Mo, W; R=Me, iPr)  

SciTech Connect (OSTI)

The enthalpies of binding of a number of N-donor ligands to the complex Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3} in toluene have been determined by solution calorimetry and equilibrium measurements. The measured binding enthalpies span a range of {approx}10 kcal mol{sup -1}: {Delta}H{sub binding} = -8.8 {+-} 1.2 (N{sub 2}-Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}); -10.3 {+-} 0.8 (N{sub 2}); -11.2 {+-} 0.4 (AdN{sub 3} (Ad = 1-adamantyl)); -13.8 {+-} 0.5 (N{sub 2}CHSiMe{sub 3}); -14.9 {+-} 0.9 (pyrazine = pz); -14.8 {+-} 0.6 (2,6-Me{sub 2}pz); -15.5 {+-} 1.8 (Me{sub 2}NCN); -16.6 {+-} 0.4 (CH{sub 3}CN); -17.0 {+-} 0.4 (pyridine); -17.5 {+-} 0.8 ([4-CH{sub 3}pz][PF{sub 6}] (in tetrahydrofuran)); -17.6 {+-} 0.4 (C{sub 6}H{sub 5}CN); -18.6 {+-} 1.8 (N{sub 2}CHC(=O)OEt); and -19.3 {+-} 2.5 kcal mol{sup -1} (pz)Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}). The value for the isonitrile AdNC (-29.0 {+-} 0.3) is 12.3 kcal mol{sup -1} more exothermic than that of the nitrile AdCN (-16.7 {+-} 0.6 kcal mol{sup -1}). The enthalpies of binding of a range of arene nitrile ligands were also studied, and remarkably, most nitrile complexes were clustered within a 1 kcal mol{sup -1} range despite dramatic color changes and variation of v{sub CN}. Computed structural and spectroscopic parameters for the complexes Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}L are in good agreement with experimental data. Computed binding enthalpies for Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}L exhibit considerable scatter and are generally smaller compared to the experimental values, but relative agreement is reasonable. Computed enthalpies of binding using a larger basis set for Mo(PMe{sub 3}){sub 2}(CO){sub 3}L show a better fit to experimental data than that for Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}L using a smaller basis set. Crystal structures of Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(AdCN), W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(Me{sub 2}NCN), W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(2,6-F{sub 2}C{sub 6}H{sub 3}CN), W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(2,4,6-Me{sub 3}C{sub 6}H{sub 2}CN), W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(2,6-Me{sub 2}pz), W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(AdCN), Mo(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(AdNC), and W(P{sup i}Pr{sub 3}){sub 2}(CO){sub 3}(AdNC) are reported.

Hoff, C.D.; Muckerman, J.; Achord, P.; Fujita, E.; Scott, B.; Fortman, G.C.; Temprado, M.; Cai, X.; Captain, B.; Isrow, D.; Weir, J.J.; McDonough, J.E.

2009-08-17T23:59:59.000Z

79

PHYSICAL REVIEW C 86, 035802 (2012) Investigation of the reaction 74  

E-Print Network [OSTI]

-Feshbach statistical model of compound reactions. Purpose: A measurement of 74 Ge(p, )75 As at low proton energies energy. The production site of the p nuclei is still under discussion but a firm basis of nuclear at low energy were found in the comparisons between previous data and calculations in the Hauser

Zilges, Andreas

80

Zeeman Effect Data and Preliminary Classification of the Spark Spectrum of PraseodymiumPr II  

Science Journals Connector (OSTI)

The Zeeman effect of praseodvmium has been studied at fields up to 95,000 oersteds over the range 2400 to 7100A. g and J values have been determined for 74 Pr II levels from resolved Zeeman patterns of 141 lines. With these data, together with new wave-length data from the M.I.T.-W.P.A. Wavelength Project which have been applied to the spectroscopic interval sorter and interval recorder, a quadratic term array has been set up which accounts for 312 lines. This array is consistent with King's temperature classification of the lines and with all previous hyperfine structure observations. It is self-consistent in g values to an average deviation of 0.005 unit, and in wave numbers to an average deviation of 0.08 cm-1. Previously published hyperfine structure measurements were found insufficiently precise to aid the classification, but were of value in its verification. The lowest term of Pr II is found to be f3(Io4)s-Io45. Most of the strong lines showing hyperfine structure arise from the f3s configuration.

Nathan Rosen; George R. Harrison; J. Rand McNally; Jr.

1941-11-15T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

PR-EDB: Power Reactor Embrittlement Data Base, Version 2. Revision 2, Program description  

SciTech Connect (OSTI)

Investigations of regulatory issues such as vessel integrity over plant life, vessel failure, and sufficiency of current codes Standard Review Plans (SRP`s) and Guides for license renewal can be greatly expedited by the use of a well-designed computerized data base. Also, such a data base is essential for the validation of embrittlement prediction models by researchers. The Power Reactor Embrittlement Data Base (PR-EDB) is such a comprehensive collection of data for US commercial nuclear reactors. The current version of the PR-EDB contains the Charpy test data that were irradiated in 252 capsules of 96 reactors and consists of 207 data points for heat-affected-zone (HAZ) materials (98 different HAZ), 227 data points for weld materials (105 different welds), 524 data points for base materials (136 different base materials), including 297 plate data points (85 different plates), 119 forging data points (31) different forging), and 108 correlation monitor materials data points (3 different plates). The data files are given in dBASE format and can be accessed with any computer using the DOS operating system. ``User-friendly`` utility programs are used to retrieve and select specific data, manipulate data, display data to the screen or printer, and to fit and plot Charpy impact data. The results of several studies investigated are presented in Appendix D.

Stallmann, F.W.; Wang, J.A.; Kam, F.B.K.; Taylor, B.J. [Oak Ridge National Lab., TN (United States)] [Oak Ridge National Lab., TN (United States)

1994-01-01T23:59:59.000Z

82

Growth of epitaxial PrO sub 2 thin films on hydrogen terminated Si (111) by pulsed laser deposition  

SciTech Connect (OSTI)

A new epitaxial oxide, PrO{sub 2}, has been grown on Si (111) by pulsed laser deposition. X-ray diffraction shows that films are oriented with the PrO{sub 2}(111) direction parallel to the substrate (111). The full width at half maximum for the omega rocking curve on the PrO{sub 2} (222) peak is as low as 0.75{degree}, while phi scans indicate {ital in}-{ital plane} epitaxial alignment to better than one degree. In the best quality films, epitaxy is almost pure type-{ital b} epitaxy which is characteristic of epitaxial CaF{sub 2} on Si. To achieve epitaxy, it is essential to remove the native silicon oxide from the substrate prior to film growth. This is done at room temperature using a wet-chemical hydrogen-termination procedure.

Fork, D.K. (Xerox Palo Alto Research Center, Palo Alto, CA (USA) Department of Applied Physics, Stanford University, Stanford, CA (USA)); Fenner, D.B. (Xerox Palo Alto Research Center, Palo Alto, CA (USA) Santa Clara University, Physics Department, Santa Clara, CA (USA)); Geballe, T.H. (Department of Applied Physics, Stanford University, Stanford, CA (USA))

1990-10-15T23:59:59.000Z

83

Characterization and thermal behavior of PrMO{sub 3} (M = Co or Ni) ceramic materials obtained from gelatin  

SciTech Connect (OSTI)

Graphical abstract: The micrograph in figure shows sample calcined at temperature 900 C. The sample exhibits morphology with considerable porosity and the formation of agglomerated nanometric particles. Gelatin provides the system with a large amount of organic matter, which is then removed during calcinations, favoring the appearance of pores in the material. Highlights: ? Oxides with PrNiO{sub 3} and PrCoO{sub 3} were prepared by new method synthesis. ? The gelatin, through its carboxylate groups and amine, is an efficient director. ? The obtained materials have magnetic properties and application in catalysis. ? The decomposition kinetic study of bonding groups of gelatin with metallic ions that takes part in the synthesis of PrMO{sub 3}. -- Abstract: Metal oxides with perovskite-type structure have attracted considerable interest in recent years due to their magnetic and electrical properties, as well as their catalytic activity. In this study, oxides with PrNiO{sub 3} and PrCoO{sub 3} composition were prepared by using gelatin powder as a precursor agent for its use as a catalyst. The powders obtained were calcined at 700 C and 900 C and characterized using the X-ray diffraction, thermal analysis (thermogravimetry and differential thermal analysis), infrared spectroscopy, temperature programed reduction and scanning electron microscopy techniques. Thermogravimetric data using the non-isothermal kinetic models of Flynn and Wall and Model-free Kinetics were used to determine the activation energy to study the decomposition kinetics of the ligand groups with system's metallic ions that takes part in the synthesis of PrMO{sub 3} (M = Ni or Co).

Aquino, F.M., E-mail: flavyma@hotmail.com [Federal University of Rio Grande of Norte, Laboratory of Catalysis and Refining NUPRAR, Av. Senador Salgado Filho, 3000, CEP 59078-970, Natal-RN (Brazil); Melo, D.M.A. [Federal University of Rio Grande of Norte, Laboratory of Catalysis and Refining NUPRAR, Av. Senador Salgado Filho, 3000, CEP 59078-970, Natal-RN (Brazil)] [Federal University of Rio Grande of Norte, Laboratory of Catalysis and Refining NUPRAR, Av. Senador Salgado Filho, 3000, CEP 59078-970, Natal-RN (Brazil); Pimentel, P.M. [Universidade Federal Rural do Semi-rido, Campus Angicos, CEP 59515-000, Angicos-RN (Brazil)] [Universidade Federal Rural do Semi-rido, Campus Angicos, CEP 59515-000, Angicos-RN (Brazil); Braga, R.M.; Melo, M.A.F.; Martinelli, A.E.; Costa, A.F. [Federal University of Rio Grande of Norte, Laboratory of Catalysis and Refining NUPRAR, Av. Senador Salgado Filho, 3000, CEP 59078-970, Natal-RN (Brazil)] [Federal University of Rio Grande of Norte, Laboratory of Catalysis and Refining NUPRAR, Av. Senador Salgado Filho, 3000, CEP 59078-970, Natal-RN (Brazil)

2012-09-15T23:59:59.000Z

84

Deterioration in donepezil-induced PR prolongation after a coadministration of memantine in a patient with Alzheimer's disease  

Science Journals Connector (OSTI)

Abstract The side effects and interaction of memantine and donepezil hydrochloride when used concomitantly are currently unknown. We encountered a case of a 77-year-old female with Alzheimer's disease in which the concomitant use of memantine exacerbated the prolonged electrocardiogram PR interval which appeared while donepezil hydrochloride was being orally administered. In terms of the cardiac circulation system side effects caused by donepezil hydrochloride and memantine, bradycardia has been reported. However, clinicians should be also aware of PR prolongation associated with the concomitant use of donepezil and memantine.

Hirofumi Igeta; Yutaro Suzuki; Takaharu Motegi; Aiko Sasaki; Yuichi Yokoyama; Toshiyuki Someya

2013-01-01T23:59:59.000Z

85

PR EPRlNT FUNDAMENTAL CONCEPTS OF DIGITAL IMAGE PROCESSING R. E. Twogood  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

88952 88952 PR EPRlNT FUNDAMENTAL CONCEPTS OF DIGITAL IMAGE PROCESSING R. E. Twogood I n v i t e d Paper f o r t h e I n t e r n a t i o n a l Symposium and Course on E l e c t r o n i c Imaging i n Medicine San Antonio, Texas March 1983 ; This is a preprint of a paper intended for publication in a journal or proceedings. Since changes may be made before publication. this preprint is made available with the un- derstanding. that it will not be cited or reproduced without the permission of the author. DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsi-

86

Pr{sup 3+}-doped fluoro-oxide lithium glass as scintillator for nuclear fusion diagnostics  

SciTech Connect (OSTI)

Experimental results are presented on the neutron scintillating properties of a custom-designed Pr3+(praseodymium)-doped lithium (Li) glass. Luminescence was observed at 278 nm wavelength, originating from the 5d-4f transition. Time-resolved measurements yielded about 20 ns decay times for ultraviolet and x-ray excitation while much faster decay times of about 6 ns were observed for alpha particle and neutron excitation. Actual time-of-flight data in laser fusion experiments at the GEKKO XII facility of the Institute of Laser Engineering, Osaka University reveal that it can clearly discriminate fusion neutrons from the much stronger x-rays signals. This material can promise improved accuracy in future scattered neutron diagnostics.

Arikawa, Yasunobu; Yamanoi, Kohei; Nakazato, Tomoharu; Estacio, Elmer Surat; Shimizu, Toshihiko; Sarukura, Nobuhiko; Nakai, Mitsuo; Norimatsu, Takayoshi; Azechi, Hiroshi [Institute of Laser Engineering, Osaka University, 2-6 Yamadaoka, Suita, Osaka 565-0871 (Japan); Murata, Takahiro [Department of Chemistry, School of Science, Tokai University, Kawayou, Minamiaso, Aso, Kumamoto 869-1404 (Japan); Fujino, Shigeru [Department of Materials Process Engineering, Graduate School of Engineering, Kyushu University, 744 Nishikyo Motooka, Fukuoka 819-0395 (Japan); Yoshida, Hideki [Ceramic Research Center of Nagasaki, Hiekoba, Hasami, Higashisonogi, Nagasaki 859-3726 (Japan); Kamada, Kei; Usuki, Yoshiyuki [Furukawa Co., Ltd., Kannondai, Tsukuba, Ibaraki 1-25-13 (Japan); Suyama, Toshihisa [Tokuyama Corporation Shibuya, 3-3-1, Shibuya, Tokyo 150-8383 (Japan); Yoshikawa, Akira [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoyou, Sendai, Miyagi 980-8577 (Japan); Sato, Nakahiro; Kan, Hirofumi [Central Research Laboratory, Hamamatsu Photonics K. K., 5000 Hiraguchi, Hamakitaku, Hamamatsu, Shizuoka 434-8601 (Japan)

2009-11-15T23:59:59.000Z

87

Hole superconductivity in the electron-doped superconductor Pr2?xCexCuO4  

Science Journals Connector (OSTI)

We measure the resistivity and Hall angle of the electron-doped superconductor Pr2?xCexCuO4 as a function of doping and temperature. The resistivity ?xx at temperatures 100K

Y. Dagan and R. L. Greene

2007-07-11T23:59:59.000Z

88

Growth and transport properties of Y-Ba-Cu-O/Pr-Ba-Cu-O superlattices  

SciTech Connect (OSTI)

The pulsed-laser deposition method has been used to fabricate epitaxial, nonsymmetric M(Y) {times} N(Pr) superlattices in which YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO) layers either M = 1,2,3,4,8, or 16 c-axis unit cells thick are separated by insulating PrBa{sub 2}Cu{sub 3}O{sub 7-x} (PBCO) layers N unit cells thick (N = 1 to {approximately}32). The zero-resistance superconducting transition temperature, T{sub c0}, initially decreases rapidly with increasing PBCO layer thickness, but then saturates at T{sub c0} {approximately} 19 K, 54 K, 71 K, or 80 K, or structures containing 1-,2-,3-, or 4-cell-thick YBCO layers, respectively. Critical current density measurements carried out on structures with 16- or 32-cell thick YBCO layers show that the magnitude of J{sub c}(H = 0) {approximately} 1-2 MA/cm{sup 2}, as well as the magnetic field dependence and the anisotropy of J{sub c}(H) all are in good agreement with corresponding measurements on thicker, single-layer YBCO films. Thus, there is no evidence of an enhanced J{sub c}(H) due to the multi-layered structure, for the layer thickness investigated to date. The systematic variation of T{sub c0}, as a function of the YBCO and PBCO layer thickness, is discussed in light of other recent experiments and theoretical model calculations. The superlattices' structural and compositional order are characterized using x-ray diffraction, transmission electron microscopy, and scanning tunneling microscopy, and details of the pulsed-laser deposition process are reported. 42 refs., 7 figs.

Lowndes, D.H.; Norton, D.P.; Budai, J.D.; Christen, D.K.; Klabunde, C.E.; Warmack, R.J.; Pennycook, S.J.

1990-01-01T23:59:59.000Z

89

Synthesis and characterization of alkali-metal titanium alkoxide compounds MTi(O-i-Pr) sub 5 (M = Li, Na, K): Single-crystal x-ray diffraction structure of (LiTi(O-i-Pr) sub 5 ) sub 2  

SciTech Connect (OSTI)

The series (MTi(O-iPr){sub 5}), M = Li, Na, or K, has been prepared by the reaction of MO-i-Pr with Ti(O-i-Pr){sub 4}. A single-crystal x-ray diffraction study revealed that (LiTi(O-i-Pr){sub 5}) crystallizes from toluene at {minus}30{degree}C in the monoclinic space group P2{sub 1}/n, with unit cell dimensions a = 11.440 (8) {angstrom}, b = 16.396 (13) {angstrom}, c = 11.838 (8) {angstrom}, {beta} = 92.59 (5){degree}, and Z = 4, as a dimer containing two approximately trigonal-bipyramidal titanium centers linked by lithium bridges. In benzene solution, all three compounds are dimeric, as revealed by cryoscopic molecular weight determination, and all three undergo an alkoxide ligand exchange process that is rapid on the {sup 1}H NMR time scale at room temperature. The positions of {nu}(M-O) are assigned based on the low-energy shifts observed upon deuteriation of the isopropoxide ligands. 23 refs., 3 figs., 3 tabs.

Hampden-Smith, M.J.; Williams, D.S. (Univ. of New Mexico, Albuquerque (USA)); Rheingold, A.L. (Univ. of Delaware, Newark (USA))

1990-10-03T23:59:59.000Z

90

arXiv:1208.5325v1[math.PR]27Aug2012 THE COMBINATORIAL APPROACH TO THE ISING  

E-Print Network [OSTI]

arXiv:1208.5325v1[math.PR]27Aug2012 THE COMBINATORIAL APPROACH TO THE ISING MODEL: FOUNDATIONS is a beautiful way to rigorously study the two-dimensional Ising model with no external field. In this paper, we in the literature. We also demonstrate how the method can be applied to prove some classical results about the Ising

Meester, Ronald

91

Reductive Alkylation of Thioamides with Grignard Reagents in the Presence of Ti(OiPr)4: Insight and Extension  

Science Journals Connector (OSTI)

The reductive alkylation of thioamides by Grignard reagents in the presence of Ti(OiPr)4 is the subject of a study involving 20 different substrates. The influence of various parameters has been evaluated, showing notably that the yields of this ...

Fabien Hermant; Ewelina Urba?ska; Sarah Seizilles de Mazancourt; Thomas Maubert; Emmanuel Nicolas; Yvan Six

2014-07-28T23:59:59.000Z

92

Probing the Role of PrP Repeats in Conformational Conversion and Amyloid Assembly of Chimeric Yeast Prions*S  

E-Print Network [OSTI]

a relatively good understanding of the factors that guide the conformational conversion of the Sup35 prion conversion of the protein Sup35, a translation termina- tion factor. In its prion conformation, Sup35Probing the Role of PrP Repeats in Conformational Conversion and Amyloid Assembly of Chimeric Yeast

Lindquist, Susan

93

Universidade Federal do Paran Setor Litoral Biblioteca UFPR Litoral Rua Jaguariava, 512 -Matinhos/ PR CEP 83260-000 Tel. (41) 3511-8336  

E-Print Network [OSTI]

Universidade Federal do Paraná ­ Setor Litoral ­ Biblioteca UFPR Litoral Rua Jaguariaíva, 512 Paraná ­ Setor Litoral ­ Biblioteca UFPR Litoral Rua Jaguariaíva, 512 - Matinhos/ PR ­ CEP 83260 Paraná ­ Setor Litoral ­ Biblioteca UFPR Litoral Rua Jaguariaíva, 512 - Matinhos/ PR ­ CEP 83260

Paraná, Universidade Federal do

94

CEWEP -Confederation of European Waste-to-Energy Plants Boulevard Clovis 12A  

E-Print Network [OSTI]

CEWEP - Confederation of European Waste-to- Energy Plants Boulevard Clovis 12A B-1000 Brussels Tel. : +32 (0)2 770 63 11 Fax : +32 (0)2 770 68 14 info@cewep.eu www.cewep.eu 1 Waste-to-Energy: towards recovery CEWEP welcomes that `energy recovery' should cover the use of waste for generating energy through

Columbia University

95

A study of radiolytic stability of 25,27-bis(2-propyloxy) calix[4]-26,28-crown-6 (iPR-C[4]C-6)  

SciTech Connect (OSTI)

The radiolytic stability of 25,27-bis(2-propyloxy)calix[4] arene -26,28-crown-6 (iPr-C[4]C-6) was studied. {sup 60}co was used as a radiation source. Its dose rate was 437 Gy/min., and the total absorbed dose of the iPr-C[4]C-6 was from 10{sup 4} to 10{sup 6} Gy. The iPr-C[4]C-6 solid and 0.025 mol/L iPr-C[4]C-6/n-octanol which were pre-equilibrated with 0.01 mol/L and 3 mol/L nitric acid, respectively, were given different doses, and their extraction performance was researched. Their degradation mechanism was investigated by mass spectrometry (MS) and infrared spectroscopy (IR). The results show that radiolytic stability of the iPr-C[4]C-6 solid and 0.025 mol/L iPr-C[4]C-6/n-octanol are good when their absorbed dose is less than 10{sup 6} Gy. The extracting system of iPr-C[4]C-6/n-octanol is promising for separating cesium from high-level liquid waste(HLLW)

Jianchen, Wang; Chongli, Song [Institute of Nuclear and New Energy Technology (INET), Tsinghua University, Beijing 102201, P.O. Box: 1021 (China)

2008-07-01T23:59:59.000Z

96

Tuning the magnetic and structural phase transitions of PrFeAsO via Fe/Ru spin dilution  

SciTech Connect (OSTI)

Neutron diffraction and muon spin relaxation measurements are used to obtain a detailed phase diagram of PrFe1{xRuxAsO. The isoelectronic substitution of Ru for Fe acts eectively as spin dilution, suppressing both the structural and magnetic phase transitions. The temperature, TS, of the tetragonal-orthorhombic structural phase transition decreases gradually as a function of x. Slightly below TS coherent precessions of the muon spin are observed corresponding to static magnetism, possibly re ecting a signicant magneto-elastic coupling in the FeAs layers. Short range order in both the Fe and Pr moments persists for higher levels of x. The static magnetic moments disappear at a concentration coincident with that expected for percolation of the J1 - J2 square lattice model.

Yiu, Yuen [ORNL; Bonfa, Pietro [University of Parma, Italy; Sanna, Samuele [Universita di Pavia, Italy; De Renzi, Roberto [University of Parma, Italy; Caretta, Pietro [Universita di Pavia, Italy; McGuire, Michael A [ORNL; Huq, Ashfia [ORNL; Nagler, Stephen E [ORNL

2014-01-01T23:59:59.000Z

97

arXiv:1101.4041v1[math.PR]20Jan2011 Randomly biased walks on subcritical trees  

E-Print Network [OSTI]

arXiv:1101.4041v1[math.PR]20Jan2011 Randomly biased walks on subcritical trees G´erard Ben Arous study the time taken for a biased random walk to return to the root of a subcritical Galton-Watson tree by the presence of subcritical trees adjacent to the backbone that may act as traps that detain the walker. Indeed

Goldschmidt, Christina

98

M. Kovari, R. Kemp, H. Lux, P. Knight, J. Morris, D.J. Ward CCFE-PR(14)12  

E-Print Network [OSTI]

.kovari@ccfe.ac.uk Abstract PROCESS is a reactor systems code ­ it assesses the engineering and economic viabilityM. Kovari, R. Kemp, H. Lux, P. Knight, J. Morris, D.J. Ward CCFE-PR(14)12 "PROCESS": a Systems Code is the copyright holder. #12;"PROCESS": a Systems Code for Fusion Power Plants - Part 1: Physics M. Kovari, R. Kemp

99

Nickel deficiency in RENi2-xP2 (RE=La, Ce, Pr). Combined crystallographic and physical property studies  

SciTech Connect (OSTI)

Large single crystals from RENi{sub 2-x}P{sub 2} (RE = La, Ce, Pr) were synthesized from the pure elements using Sn as a metal flux, and their structures were established by X-ray crystallography. The title compounds were confirmed to crystallize in the body-centered tetragonal ThCr{sub 2}Si{sub 2} structure type (space group I4/mmm (No. 139); Pearson's symbol tI10), but with a significant stoichiometry breadth with respect to the transition metal. Systematic synthetic work, coupled with accurate structure refinements indicated strong correlation between the degree of Ni-deficiency and the reaction conditions. For four different PrNi{sub 2-x}P{sub 2} (x {le} 0.5) samples, temperature dependent dc magnetization measurements indicated typical local moment 4f-magnetism and a stable Pr{sup 3+} ground state. Field-dependent heat capacity data confirmed a ferromagnetic order at low temperature, and the variations of T{sub c} with the concentration of Ni defects are discussed. LaNi{sub 2-x}P{sub 2}, as expected was found to be Pauli-like paramagnetic in the studied temperature regime, while the Ce-analog CeNi{sub 2-x}P{sub 2} (x = 0.28(1)) showed the characteristics of a mixed valent Ce{sup 3+}/Ce{sup 4+} system with a possible Kondo temperature on the order of 230 K.

Bauer, Eric D [Los Alamos National Laboratory; Ronning, Filip [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Sarrao, John L [Los Alamos National Laboratory; Bobev, S [U. OF DE; Xia, S [U. OF DE

2008-01-01T23:59:59.000Z

100

Analysis of structural and electronic properties of Pr2NiO4 through first-principles calculations  

Science Journals Connector (OSTI)

The structural and electronic properties of bulk Pr2NiO4+? (?=0 and 0.031) were analyzed using first-principles calculations based on the density functional theory (DFT) for application to electrode materials in solid-oxide fuel cells (SOFCs). Two structures of Pr2NiO4 were analyzed: one in space group I4/mmm associated with the high temperature tetragonal (HTT) structure, and the other in Bmab with the low temperature orthorhombic (LTO) structure. The main difference between the two structures is the pronounced tilting of the nickelate octahedra found in the Bmab structure. Here, we will show that the difference in the electronic properties between the two structures, i.e.half-metallic for the I4/mmm structure and metallic for the Bmab structure, is attributed to the tilting of the nickelate octahedra. Furthermore, we found that the presence of interstitial O atoms at the Pr2O2 bilayers is responsible for the tilting of the octahedra and thus is a dominant factor in the transition from the I4/mmm structure to the Bmab structure. These results would be of great significance to materials design related to the enhancement of O diffusivity in this material.

S M Aspera; M Sakaue; T D K Wungu; M Alaydrus; T P T Linh; H Kasai; M Nakanishi; T Ishihara

2012-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Photoluminescence properties and energy levels of RE (RE?=?Pr, Sm, Er, Tm) in layered-CaZnOS oxysulfide  

SciTech Connect (OSTI)

RE{sup 3+} (RE?=?Pr, Sm, Er, Tm)-activated CaZnOS samples were prepared by a solid-state reaction method at high temperature, and their photoluminescence properties were investigated. Doping with RE{sup 3+} (RE?=?Pr, Sm, Er, Tm) into layered-CaZnOS resulted in typical RE{sup 3+} (RE?=?Pr, Sm, Er, Tm) f-f line absorptions and emissions, as well as the charge transfer band of Sm{sup 3+} at about 3.3?eV. The energy level scheme containing the position of the 4f and 5d levels of all divalent and trivalent lanthanide ions with respect to the valence and conduction bands of CaZnOS has been constructed based on the new data presented in this work, together with the data from literature on Ce{sup 3+} and Eu{sup 2+} doping in CaZnOS. The detailed energy level scheme provides a platform for interpreting the optical spectra and could be used to comment on the valence stability of the lanthanide ions in CaZnOS.

Zhang, Zhi-Jun, E-mail: zhangzj@mail.sic.ac.cn [Key Laboratory of Transparent Opto-Functional Inorganic Materials of Chinese Academy of Sciences, Shanghai Institute of Ceramics, Shanghai 200050 (China); Feng, Ang; Chen, Xiang-Yang [Key Laboratory of Transparent Opto-Functional Inorganic Materials of Chinese Academy of Sciences, Shanghai Institute of Ceramics, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Zhao, Jing-Tai, E-mail: jtzhao@mail.sic.ac.cn [Key Laboratory of Transparent Opto-Functional Inorganic Materials of Chinese Academy of Sciences, Shanghai Institute of Ceramics, Shanghai 200050 (China); School of Materials Science and Engineering, Shanghai University, Shanghai 200072 (China)

2013-12-07T23:59:59.000Z

102

Neutron Scattering Study of Charge-Ordering in R1/3Sr2/3FeO3(R=La, Pr, Nd, Sm, and Y).  

E-Print Network [OSTI]

??The series of compounds R1/3Sr2/3FeO3 (R = La, Pr, Nd, and Sm) undergo a Verwey transition along with an antiferromagnetic ordering of Fe spins as (more)

Ma, Jie

2010-01-01T23:59:59.000Z

103

Glass-like recovery of antiferromagnetic spin ordering in a photo-excited manganite Pr0.7Ca0.3MnO3  

E-Print Network [OSTI]

of topological defects in a photo-excited charge-orderedspin ordering in a photo-excited manganite Pr 0.7 Ca 0.3 MnO3 following ultrafast photo-exitation. Our studies reveal a

Zhou, S.Y.

2014-01-01T23:59:59.000Z

104

Anomalous Chemical Expansion Behavior of Pr[subscript 0.2]Ce[subscript 0.8]O[subscript 2-?] Thin Films Grown by Pulsed Laser Deposition  

E-Print Network [OSTI]

The chemomechanical and electrical properties of (Pr,Ce)O[subscript 2-?] thin films were studied between 30 and 875C in air by in situ X-ray diffraction and complex impedance spectroscopy measurements. Reduction/oxidation ...

Kuru, Y.

105

X-ray Absorption and Emission Spectroscopy Study of the Effect of Doping on the Low Energy Electronic Structure of PrFeAsO1-[delta  

E-Print Network [OSTI]

X-ray Absorption and Emission Spectroscopy Study of theusing soft X-ray absorption and emission spectroscopy. The2. (a) Oxygen 1s x-ray absorption spectra of PrFeAsO 1-? (?

Freelon, Byron

2010-01-01T23:59:59.000Z

106

Implications for advanced safeguards derived from PR&PP case study results  

SciTech Connect (OSTI)

The proliferation resistance and physical protection (PR and PP) working group produced a case study on the Example Sodium Fast Reactor (ESFR). The ESFR is a hypothetical nuclear energy system consisting of four sodium-cooled fast reactors of medium size collocated with an on-site dry fuel storage facility and a spent fuel reprocessing facility using pyroprocessing technology. This study revealed how safeguards would be applied at such site consisting of integrated multiple fuel cycle facilities and the implications of what safeguards technology and safeguards concepts would need to be adapted and developed to safeguard successfully this Generation IV nuclear energy system concept. The major safeguards concepts driving our safeguards analysis are timeliness goals and material quantity goals. Because the fresh transuranic (TRU) fuel to be produced in the ESFR fuel fabrication facility contains plutonium, the ESFR will be reprocessing, using in the reactor, and storing material on site that will have IAEA defined 'direct-use material' in it with stringent timeliness goals and material quantity goals that drive the safeguards implementation. Specifically, the TRU fresh fuel, pyroprocessing in process material, LWR spent fuel sent to the ESFR, and TRU spent fuel will contain plutonium. This material will need to be verified at interim intervals four times per year because the irradiated direct-use material, as defined previously, has three-month timeliness goals and 8 kg material quantity goals for plutonium. The TRU in-process material is, of course, irradiated direct-use material as defined by the IAEA. Keeping the plutonium and uranium together with TRu products should provide a radiation barrier. this radiation barrier slows down the ability to reprocess the fuel. Furthermore, the reprocessing technique, if it has some intrinsic proliferation resistance, will need major modifications to be able to separate plutonium from the uranium and TRU mixture. The ESFR design should have such features in it if it is seen to have intrinsic proliferation resistance. The technical difficulty in diverting material from the ESFR is at least as strongly impacted by the adversaries overall technical capabilities as it is by the effort required to overcome those barriers intrinsic to the nuclear fuel cycle. The intrinsic proliferation resistance of the ESFR will affect how extrinsic measures in the safeguards approach for the ESFR will provide overall proliferation resistance.

Boyer, Brian D [Los Alamos National Laboratory

2009-01-01T23:59:59.000Z

107

Structure-property relationship of nanocrystalline Pr{sub 2}Co{sub 14}B-based hard magnetic film  

SciTech Connect (OSTI)

Nanocrystalline Pr{sub 2}Co{sub 14}B-based films are deposited on two types of substrates at 600 deg. C by radio frequency magnetron sputtering. All samples are composed of a hard magnetic phase Pr{sub 2}Co{sub 14}B and a small amount of a soft magnetic phase Co{sub 3}B. The film sputtered on the thermally oxidized silicon wafer has a more dispersed distribution of Co{sub 3}B and a smaller average grain size of Pr{sub 2}Co{sub 14}B than that deposited on alumina substrates; therefore, the former film shows a stronger intergrain exchange coupling action (IECA) than the latter film. In addition, the coercivity (8.6 kOe) and ratio (0.68) of remanence to saturation magnetization of the film sputtered on thermally oxidized silicon wafers are considerably higher than those (0.4 kOe and 0.56) of the film deposited on alumina substrates. In the case of the film sputtered on alumina substrates, the size of most magnetic domains is comparable to the average grain size of magnetic phases, implying the occurrence of a weak IECA. However, in the case of the film sputtered on thermally oxidized silicon wafers, the size of most magnetic domains is considerably larger than the mean grain size of magnetic phases, indicating the occurrence of a strong IECA. The effect of the IECA on the coercivity of specimens is determined by analyzing the temperature dependence of coercivity in the framework of a nucleation model.

Zhang, W. Y.; Shima, H.; Takano, F.; Akinaga, H. [Nanodevice Innovation Researcher Center (NRIC), National Institute of Advanced Industrial Science and Technology (AIST), Tsukuba Central 2, 1-1-1 Umezono, Tsukuba, Ibaraki 305-8568 (Japan); Nimori, S. [Tsukuba Magnet Laboratory (TML), National Institute for Materials Science (NIMS), 3-13 Sakura, Tsukuba 305-0003 (Japan)

2009-12-01T23:59:59.000Z

108

Genome Sequence of Pseudomonas putida S12, a Potential Platform Strain for Industrial Production of Valuable Chemicals  

Science Journals Connector (OSTI)

...S12, a Potential Platform Strain for Industrial...Production of Valuable Chemicals Fei Tao a Yaling...is considered a platform strain for the production of many chemicals. Here, we present...S12, a potential platform strain for industrial...production of valuable chemicals. | Pseudomonas...

Fei Tao; Yaling Shen; Ziqi Fan; Hongzhi Tang; Ping Xu

2012-11-01T23:59:59.000Z

109

Pion correlations for 1.2A GeV lanthanum on lanthanum  

Science Journals Connector (OSTI)

Results are presented for pion interferometry measurements of 1.2A GeV La+La at the Lawrence Berkeley Laboratory Heavy Ion Spectrometer System. The experiments acceptance is at forward angles in the center-of-mass system. The fit parameters R, ?, ?, R?, and R? are presented. The extracted shape of the pion source is oblate. The correlation between the extracted size of the pion source and the centrality of the collision is investigated as well as the dependence of the source size on the mean momentum of the pion pairs. We conclude that the fitted radius parameters scale with mass for symmetric systems. We observe a dependence of the fitted size of the pion source on the mean momentum of the pion pairs. Comparisons are made with previous results.

W. B. Christie; D. L. Olson; C. E. Tull; F. P. Brady; G. P. Grim; J. H. Osborne; M. L. Partlan; J. L. Romero; J. Chang; S. Y. Fung; J. Kang; S. Zhang; D. Keane; D. Beavis; Y. Dardenne

1993-02-01T23:59:59.000Z

110

PREGO ELETRNICO N 11/2012 =SRP VALIDADE 26/06/12 a 25/06/13  

E-Print Network [OSTI]

PREG?O ELETR?NICO Nº 11/2012 =SRP VALIDADE 26/06/12 a 25/06/13 AQUISI??O DE CARTUCHO DE TONER e

Paraná, Universidade Federal do

111

Rua XV de Novembro, 1299 Centro CEP 80060-000 Curitiba PR Fone (41) 3360-5199 Fax (41) 3360-5386 dsg@ufpr.br MINISTRIO DA EDUCAO  

E-Print Network [OSTI]

Rua XV de Novembro, 1299 ­ Centro ­ CEP 80060-000 ­ Curitiba ­ PR ­ Fone (41) 3360-5199 ­ Fax (41: ________________________) REITORIA Rua XV de Novembro, 1299. Centro, Curitiba ­ PR CEP: 80060-000 PROGEPE Rua Dr. Faivre, 405. Centro, Curitiba ­ PR CEP: 80060-140 CAMPUS CENTRO POLIT?CNICO Rua Cel. Francisco H. dos Santos, 210 (esquina c

Paraná, Universidade Federal do

112

Biodegradation of phenoxyacetic acid in soil by pseudomonas putida PP0301(PR0103), a constitutive degrader of 2,4-dichlorophenoxyacetate  

SciTech Connect (OSTI)

The efficacy of using genetically engineered microbes (GEMs) to degrade recalcitrant environmental toxicants was demonstrated by the application of Pseudomonas putida PP0301(pR0103) to an Oregon agricultural soil amended with 500 microg/g of a model xenobiotic, phenoxyacetic acid (PAA). P. putida PP0301(pR0103) is a constitutive degrader of 2,4-dichlorophenoxyacetate (2,4-D) and is also active on the non-inducing substrate, PAA. In unamended soil, survival of the plasmid-free parental strain P. putida PP0301 was similar to the survival of the GEM strain P. putida PP0301(pR103). However, in PAA amended soil, survival of the parent strain was over 10,000-fold lower (<3 colony forming units per gram of soil) than survival of the GEM strain after 39 days.

Short, K.A.; King, R.J.; Seidler, R.J.; Olsen, R.H.

1992-01-01T23:59:59.000Z

113

Rua XV de Novembro, 1299 Centro CEP 80060-000 Curitiba PR Fone (41) 3360-5199 Fax (41) 3360-5386 dsg@ufpr.br MINISTRIO DA EDUCAO  

E-Print Network [OSTI]

Rua XV de Novembro, 1299 ­ Centro ­ CEP 80060-000 ­ Curitiba ­ PR ­ Fone (41) 3360-5199 ­ Fax (41

Paraná, Universidade Federal do

114

Suppression of superconductivity in the R(Ba1-zRz)2Cu3O7+? (R=Pr,Nd) system  

Science Journals Connector (OSTI)

Structural and superconducting behavior of samples prepared with the nominal compositions of Nd1.05(Ba1-zPrz)1.95Cu3O7+? has been investigated by neutron-diffraction and dc magnetization measurements. Neutron data refined by the Reitveld method showed that there is mixing of the rare-earth (R) ions with a substantial fraction of the Pr going to the normal R site in the RBa2Cu3O7+?-type structure and a corresponding fraction of the Nd going to the Ba site. Structural changes due to the trivalent R ions going to the Ba site are very similar to those observed in the Nd1+xBa2-xCu3O7+? (Nd123ss), indicating that Pr behaves like other trivalent Rs on the divalent Ba site. Magnetization measurements show that the depression in Tc is more pronounced for the Pr bearing samples than that for Nd123ss for the same number of trivalent ions on the Ba site. However, by correcting the changes in Tc for the depression associated with the fraction of Pr on the R site, the depression in Tc per trivalent ion on the divalent site is found to be identical to that in other light R123ss. Thus the depression in superconductivity in this series of samples is due to two independent effects: (1) Pr on the R site and (2) hole localization due to trivalent R ions on the Ba site. In this respect, Pr on the Ba site appears to behave like all the other trivalent R ions.

M. J. Kramer; K. W. Dennis; D. Falzgraf; R. W. McCallum; S. K. Malik; W. B. Yelon

1997-09-01T23:59:59.000Z

115

NaLaF{sub 4}:Pr{sup 3+},Yb{sup 3+}, an efficient blue to near infra-red quantum cutter  

SciTech Connect (OSTI)

In order to reduce the thermalization losses in solar cells, down-conversion of blue photons into near infra-red photons is a promising solution. In the present paper, we analyse the energy transfer processes between Pr{sup 3+} and Yb{sup 3+} in NaLaF{sub 4} and we show that an efficient quantum-cutting process occurs. Nevertheless, we also show that a back transfer from Yb{sup 3+} toward the {sup 1}G{sub 4} level of Pr{sup 3+} ion leading to emission beyond 1??m reduces the potentiality of this material as a quantum cutter for Si solar cells.

Guille, A.; Pereira, A.; Moine, B., E-mail: bernard.moine@univ-lyon1.fr [Universit Lyon 1, CNRS UMR 5306, Institut Lumire Matire, Universit de Lyon, F-69622 Villeurbanne (France)

2013-12-01T23:59:59.000Z

116

Determination of the properties of nuclear energy levels of La? and Pr? by the resonance fluorescence of neutron capture gamma rays  

E-Print Network [OSTI]

DE ERMINATION OF THE PROPERTIES OF NUCLEAR ENEPGY LEVELS OF La~ AND Pr-"' BY THE RESCNANCE FLUORESCENCE CF Ni". UTRON CAPTURE BAI'IMA RAYS A Thesis William Bradley Wilson Submitted to the Graduate College of Texas ASM University in partial... fulfil'men o. the reouirement for ti. e degr e of Master of Science January, 1969 MaJ'or Sub) ect Nuclea Eng. '. u:eering DE' EPM1INATION OF THE PROPERTIES OF NUCLEAR ENERGY LEVELS OF La ~ AND Pr'" BY THE RFSONANCE FLUORESCENCE OF NEUTRON CAP URE...

Wilson, William Bradley

2012-06-07T23:59:59.000Z

117

REGISTRATION LIST P PR RE ES SO OL LI IC CI IT TA AT TI IO ON  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

REGISTRATION LIST REGISTRATION LIST P PR RE ES SO OL LI IC CI IT TA AT TI IO ON N C CO ON NF FE ER RE EN NC CE E August 9, 2011 Holiday Inn Capitol  550 C Street, SW  Washington, DC 20024 Page 1 of 9 Instructions: (iii) Please indicate (by checking the appropriate box) whether the organization you represent is a large business, small business, or not a business. (iv) Please indicate (by checking the appropriate box) whether your name or the name of your organization may be released on the NNSA website as an attendee of this conference. (v) Please provide an email address if you would like it to be released on the NNSA website. An email address cannot be released if you select neither in column (iv). Name Organization Name Large/Small (iii) Release Attendance? (iv) Email (to release)

118

Data:E6b74c86-7700-4665-9871-9ce5ff669295 | Open Energy Information  

Open Energy Info (EERE)

7700-4665-9871-9ce5ff669295 7700-4665-9871-9ce5ff669295 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Jackson, Tennessee (Utility Company) Effective date: 2012/08/01 End date if known: Rate name: General Service GSA3 Sector: Commercial Description: General Service GSA3. Source or reference: http://www.jaxenergy.com/rates/downloads/ELECTRIC_R.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

119

C. Rdiger, J.P. Walker, J.D. Kalma, G.R. Willgoose, and P.R. Houser (2004), Streamflow data assimilation: A study on nested catchments,  

E-Print Network [OSTI]

assimilation: A study on nested catchments, in Proceedings of the 2nd international CAHMDA workshop on: The Ter.P. Walker1, J.D. Kalma2, G.R. Willgoose3, and P.R. Houser4 1Dept. of Civil and Environmental Engineering "observations" and the evaluation data. The initial conditions and land surface forcing data are then degraded

Walker, Jeff

120

Specific binding of gibberellic acid by Cytokinin-Specific Binding Proteins: a new aspect of plant hormone-binding proteins with the PR-10 fold  

Science Journals Connector (OSTI)

Two plant cytokinin-specific binding proteins were crystallized in complex with gibberellic acid (GA3), which is an entirely different plant hormone. The crystal structures, determined at high resolution, reveal a highly specific mode of GA3 binding, calling for a revision of the hormone specificity of plant proteins with the PR-10 fold.

Ruszkowski, M.

2014-06-29T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Raman spectrum and ESR of Pr0.5Ca0.4Sr0.1MnO3  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Raman spectrum and ESR of Pr 0.5 Ca 0.4 Sr 0.1 MnO 3 H.-D. Zhou a , G. Li a , F. Liu a , S.-J. Feng a , Y. Liu a , X.-G. Li a, * , J. Fang b a Structure Research Laboratory,...

122

FACULTY OF ENGINEERING AND THE BUILT ENVIRONMENT DEAN: PROFESSOR BM LACQUET PrEng BSc(Hon)(Elect) MIng(Elect) DIng (RAU) FSAAE  

E-Print Network [OSTI]

1 FACULTY OF ENGINEERING AND THE BUILT ENVIRONMENT DEAN: PROFESSOR BM LACQUET PrEng BSc(Hon)(Elect) MIng(Elect) DIng (RAU) FSAAE Doctor of Philosophy AFENI, Busuyi Thomas School of Mining Engineering measurement in a surface mine environment. The impact of taking measurement through a glass medium BUGARIN

Wagner, Stephan

123

Light-induced oxygen-ordering dynamics in ,,Y,Pr...Ba2Cu3O6.7: A Raman spectroscopy and Monte Carlo study  

E-Print Network [OSTI]

Light-induced oxygen-ordering dynamics in ,,Y,Pr...Ba2Cu3O6.7: A Raman spectroscopy and Monte Carlo energy barrier which impedes oxygen movement in the plane unless the oxygen atoms are excited by light for oxygen reordering in the chain plane being at the origin of Raman photobleaching and related effects. DOI

Nabben, Reinhard

124

Oxygen diffusion, surface exchange and oxygen semi-permeation performances of Ln2NiO4+ membranes (Ln = La, Pr and Nd)  

E-Print Network [OSTI]

Oxygen diffusion, surface exchange and oxygen semi-permeation performances of Ln2NiO4+ membranes the rate determining step (rds) in oxygen semi-permeation of dense Ln2NiO4+ membranes (with Ln = La, Pr and Nd), a specific setup has been designed, which allowed measuring the oxygen semi-permeation flux

Paris-Sud XI, Université de

125

Effect of antiferromagnetic spin correlations on lattice distortion and charge ordering in Pr0.5Ca1.5MnO4  

Science Journals Connector (OSTI)

...correlations on lattice distortion and charge ordering in Pr0.5Ca1.5MnO4 10.1073/pnas.0704303104 Songxue Chi F. Ye Pengcheng Dai J. A. Fernandez-Baca Q. Huang J. W. Lynn E. W. Plummer R. Mathieu Y. Kaneko Y. Tokura *Department of Physics...

Songxue Chi; F. Ye; Pengcheng Dai; J. A. Fernandez-Baca; Q. Huang; J. W. Lynn; E. W. Plummer; R. Mathieu; Y. Kaneko; Y. Tokura

2007-01-01T23:59:59.000Z

126

Electronic and optical properties of layered RE{sub 2}Ti{sub 2}O{sub 7} (RE = Ce and Pr) from first principles  

SciTech Connect (OSTI)

We have studied the structural and electronic properties of Ce{sub 2}Ti{sub 2}O{sub 7} (CeTO) and Pr{sub 2}Ti{sub 2}O{sub 7} (PrTO) by first-principles density functional theory calculations. The computed structural parameters are in fairly good agreement with the available experimental findings. Band structure calculations using the GGA+U approach predict an insulating ground state for the herein studied compounds. The insulating band gaps of 2.00 eV and 2.83 eV are found for CeTO and PrTO, respectively. The analysis of the density of states reveals that the strongly localized RE 4f levels act as charge-trapping sites, predicting a lower photocatalytic activity for CeTO. We have also calculated the optical properties for both CeTO and PrTO. Based on these properties, it is predicted that these titanates are insensitive to ultra-violet radiation, while they are more sensitive to frequencies of the radiation in visible and early UV regions.

Sayede, A. [Universite Lille Nord de France, F-59000 Lille (France); Khenata, R. [Laboratoire de Physique Quantique et de Modlisation Mathmatique, Universite de Mascara, Mascara, 29000 (Algeria); Chahed, A.; Benhelal, O. [Condensed Matter and Sustainable Development Laboratory, Djillali Liabes University of Sidi Bel-Abbes, Sidi Bel-Abbes 22000 (Algeria)

2013-05-07T23:59:59.000Z

127

Magnetic properties of MoS2: Existence of ferromagnetism Sefaattin Tongay,1,2,a),b)  

E-Print Network [OSTI]

Magnetic properties of MoS2: Existence of ferromagnetism Sefaattin Tongay,1,2,a),b) Sima S 4 September 2012; published online 18 September 2012) We report on the magnetic properties of MoS2 measured from room temperature down to 10K and magnetic fields up to 5 T. We find that single crystals

Wu, Junqiao

128

Fire and Emergency Management Group SLAC-I-730-0A12A-001-R000  

E-Print Network [OSTI]

Fire and Emergency Management Group SLAC-I-730-0A12A-001-R000 Fire Protection System Impairment NFPA National Fire Protection Association SLAC Stanford Linear Accelerator Center SSO DOE Stanford Site000 iii #12;#12;1 Introduction This document describes the fire protection system impairment program

Wechsler, Risa H.

129

Doping-induced metal-insulator transition in aluminum-doped 4H silicon P. Achatz,1,2,a  

E-Print Network [OSTI]

Doping-induced metal-insulator transition in aluminum-doped 4H silicon carbide P. Achatz,1,2,a J an experimental determination of the doping-induced metal-insulator transition in aluminum-doped 4H silicon concentration lying between 6.4 and 8.7 1020 cm-3 for the metal-insulator transition in these epilayers grown

Paris-Sud XI, Université de

130

Signature of magnetic phase separation in the ground state of Pr1-xCaxMnO3  

SciTech Connect (OSTI)

Neutron scattering has been used to investigate the evolution of the long- and short-range charge-ordered (CO), ferromagnetic (FM), and antiferromagnetic (AF) correlations in single crystals of $\\rm Pr_{1-x}Ca_{x}MnO_3$ ($x$ = 0.3, 0.35 and 0.4). These correlations are a ssociated with the existence of spin clusters with populations that drastically depend on the doping ($x$) and temperature. Concentrated spin clusters coexist with long-range canted AF order in a wide temperature range for $x$ = 0.3 while clusters do not appear in the $x$ = 0.4 crystal. In contrast, both CO and AF order parameters in the $x$ = 0.35 crystal show a precipitous decrease below $\\sim$ 35 K where spin clusters form. These results provide direct evidence of magnetic phase separation and indicate that there is a critical doping $x_{c}$ (close to $x$ = 0.35) that divides the phase-separated site-centered from the homogeneous bond-centered or charge-disproportionated CO ground state.

Sha, Hao [Florida International University, Miami; Ye, Feng [ORNL; Dai, Pengcheng [ORNL; Fernandez-Baca, Jaime A [ORNL; Mesa, Dalgis [ORNL; Lynn, J. W. [National Institute of Standards and Technology (NIST); Tomioka, Y. [Correlated Electron Research Center (CERC), Japan; Tokura, Y. [University of Tokyo, Tokyo, Japan; Zhang, Jiandi [Florida International University, Miami

2008-01-01T23:59:59.000Z

131

Data:244cda0a-21fd-4059-889a-12a0147a129b | Open Energy Information  

Open Energy Info (EERE)

a-21fd-4059-889a-12a0147a129b a-21fd-4059-889a-12a0147a129b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Monroe, North Carolina (Utility Company) Effective date: 2013/06/01 End date if known: Rate name: Schedule TS - Traffic Signal Service Sector: Lighting Description: Source or reference: http://www.monroenc.org/services.php?cat=150 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

132

Data:1844e12d-12a3-4722-a554-be3c170bffaa | Open Energy Information  

Open Energy Info (EERE)

e12d-12a3-4722-a554-be3c170bffaa e12d-12a3-4722-a554-be3c170bffaa No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Tell City, Indiana (Utility Company) Effective date: 2008/07/01 End date if known: Rate name: Tariff A1: Single Phase Residential, Greater Than 200 Amps and Less Than 400 Amps Sector: Residential Description: The charges derived in the Tariff A1 rate are subject to adjustment for: Purchased Power Adjustment Tracking Factor. Source or reference: Rates Binder 1, Illinois State University Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months):

133

Data:33d1657d-8616-4475-94a0-e6ed12a79571 | Open Energy Information  

Open Energy Info (EERE)

d1657d-8616-4475-94a0-e6ed12a79571 d1657d-8616-4475-94a0-e6ed12a79571 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Belmont, Wisconsin (Utility Company) Effective date: 2005/01/21 End date if known: Rate name: Rg-1 Residential Service Single Phase Sector: Residential Description: This rate will be applied to residential single phase customers for ordinary household purposes. Single-Phase motors may not exceed 5 horsepower individual-rated capacity without utility permission. Fixed Monthly Charge includes Commitment to Community Rider: $1.00 per customer per month Source or reference: http://psc.wi.gov/apps40/tariffs/viewfile.aspx?type=electric&id=440

134

Superconductivity suppression of R(Ba1-zRz)2Cu3O7+? (R=Nd, Pr) probed by soft-x-ray absorption spectroscopy  

Science Journals Connector (OSTI)

O K-edge x-ray-absorption near-edge-structure (XANES) spectra of (Nd1-xPrx)1.05Ba1.95Cu3O7 for x=00.5 and Nd1.05(Ba1-zPrz)1.95Cu3O7+? for z=00.25 were performed to search for microstructural features and hole distribution related to the superconducting properties. Near the O 1s edge, prepeaks at ?527.6 and ?528.3 eV are assigned to transitions into O 2p holes located in the CuO3 ribbons and CuO2 planes, respectively. As deduced from O 1s absorption spectra of (Nd1-xPrx)1.05Ba1.95Cu3O7 for x=00.5, the hole concentrations in the CuO2 planes and CuO3 ribbons decrease monotonically with increasing Pr doping. The present XANES results clearly reveal that the suppression of superconductivity with Pr doping in (Nd1-xPrx)1.05Ba1.95Cu3O7 results predominantly from the hole depletion effect. The effect of Pr on the Ba site in Nd1.05(Ba1-zPrz)1.95Cu3O7+? is to reduce the hole concentration in the CuO2 planes and to create localized fivefold Cu chain sites. Tc of Nd1.05(Ba1-zPrz)1.95Cu3O7+? is depressed upon Pr doping, primarily due to hole filling and hole localization. Compared to (Nd1-xPrx)1.05Ba1.95Cu3O7, the enhanced suppression of Tc in Nd1.05(Ba1-zPrz)1.95Cu3O7+? is primarily due to the hole localization.

J. M. Chen; R. S. Liu; P. Nachimuthu; M. J. Kramer; K. W. Dennis; R. W. McCallum

1999-02-01T23:59:59.000Z

135

Crystal structure of N-(tert-butoxycarbonyl)phenylalanyldehydroalanine isopropyl ester (Boc-Phe-Ala-OiPr)  

Science Journals Connector (OSTI)

In the crystal structure of the dehydrodipeptide (Boc-Phe-Ala-OiPr), the molecule has a trans configuration of the N-methylamide group. Its geometry is different from saturated peptides but is in excellent agreement with other dehydroalanine compounds. In the crystal, an N-HO hydrogen bond links the molecules in a herringbone packing arrangement.

Lenartowicz, P.

2014-11-29T23:59:59.000Z

136

PRAE Pr-Reitoria de Assuntos Estudantis Dr. Faivre, 405 -Edifcio Dom Pedro II 1 andar -CEP: 80060-140 Curitiba Paran  

E-Print Network [OSTI]

de Estudos do Mar, após o dia 12 de setembro. Curitiba: PRAE: Rua Dr. Faivre, 405 Ed. D. Pedro II Universitário (em dias e horários a serem divulgados). Campus Palotina: UAPS: Prédio do SEMINÁRIO Rua: Vinte e dos Campi de Curitiba No Campus Palotina: Bloco Didático II - Campus Palotina - Rua Pioneiro, 2153

Paraná, Universidade Federal do

137

PR 09 12  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

transmission lines, delivers renewable Northwest hydropower and increasing amounts of wind energy to California, while carrying electricity north to meet winter demand in the...

138

PR 30 12  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

toll). Turn left (west) onto State Route 14. Go about 3 miles (one mile past Second Powerhouse) to Dam Access Road. Turn left onto Dam Access Road and stay to the left until you...

139

P270-PR  

National Nuclear Security Administration (NNSA)

quarter of2008 and update to the Opemlions Plan (l2-month look ahead). The BUreall of Air Pollution Control (BAPC) requires this infonnalion within 30 days ofthe end of each...

140

Inl J ~lid~ Slructure~ Vol 19. No 6. pp 5~-5"~9. t98?~ ~)20-7~3/83106053~07S030010 Pr,meot in Grea~ Br~.~m PergamonPress Lid  

E-Print Network [OSTI]

Inl J ~lid~ Slructure~ Vol 19. No 6. pp 5~-5"~9. t98?~ ~)20-7¢~3/83106053~07S030010 Pr,meot in Grea

Barber, James R.

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

JOURNAL DE PHYSIQUE Colloque C6, supplment au n 8, Tome 39, aot 1978, page C6-1010 MAGNETIC EXCITATIONS AND THE COOPERATIVE JAHN-TELLER TRANSITION IN PrCu2  

E-Print Network [OSTI]

. The structural phase transition was first observed in specific heat measurements /5/ which indicated EXCITATIONS AND THE COOPERATIVE JAHN-TELLER TRANSITION IN PrCu2 J.K. Kjems , H.R. Ott , S.M. Shapiro , and K'interaction quadrupolaire dominante entre les ions Pr + . Une tran- sition dipolaire vers le deuxième état excité est

Boyer, Edmond

142

Rua Bom Jesus n 650, Juvev, Curitiba PR CEP: 80035-010 Fone/Fax: (41) 3313-2042/ 3313-2045/ e-mail: maert@ufpr.br  

E-Print Network [OSTI]

Rua Bom Jesus nº 650, Juvevê, Curitiba ­ PR CEP: 80035-010 Fone/Fax: (41) 3313-2042/ 3313-2045/ e de Souza Tassiane Correa Fontoura #12;Rua Bom Jesus nº 650, Juvevê, Curitiba ­ PR CEP: 80035-010 Fone a bolsa, solicitamos que compareçam na Reserva Técnica do MAE ( Rua Bom Jesus, 650 - Campus Juvevê), até o

Paraná, Universidade Federal do

143

Rua Padre Camargo, 280 7 andar Bairro Alto da Glria CEP 80.060-240 Curitiba PR Fone/Fax: (41) 3360-7268 email: medtrab2008@ufpr.br / medtrabufpr@hotmail.com  

E-Print Network [OSTI]

Rua Padre Camargo, 280 ­ 7º andar ­ Bairro Alto da Glória ­ CEP 80.060-240 ­ Curitiba ­ PR Fone, impreterivelmente. Edital dos aprovados será divulgado até o dia 30/03/2012. #12;Rua Padre Camargo, 280 ­ 7º andar.brv Secretaria do Curso Rua Padre Camargo, 280 ­ 7º andar - Bairro Alto da Glória - Curitiba ­ PR com Kátia

Paraná, Universidade Federal do

144

Rua Padre Camargo, 280 7 andar Bairro Alto da Glria CEP 80.060-240 Curitiba PR Fone/Fax: (41) 3360-7268 email: medtrab2008@ufpr.br / medtrabufpr@hotmail.com  

E-Print Network [OSTI]

Rua Padre Camargo, 280 ­ 7º andar ­ Bairro Alto da Glória ­ CEP 80.060-240 ­ Curitiba ­ PR Fone, impreterivelmente. Edital dos aprovados será divulgado até o dia 17/03/2014. #12;Rua Padre Camargo, 280 ­ 7º andar.brv Secretaria do Curso Rua Padre Camargo, 280 ­ 7º andar - Bairro Alto da Glória - Curitiba ­ PR com Kátia

Paraná, Universidade Federal do

145

Synthesis of the Sterically Related Nickel Gallanediyl Complexes [Ni(CO)3(GaAr?)] (Ar?=C6H3-2,6-(C6H3-2,6-iPr2)2) and [Ni(CO)3(GaL)] (L=HC[C(CH3)N(C6H3-2,6-iPr2)]2): Thermal Decomposition of [Ni(CO)3(GaAr?)] to give the Cluster [Ni4(CO)7(GaAr?)3  

E-Print Network [OSTI]

6 H 3 -2,6-(C 6 H 3 -2,6-iPr 2 ) 2 ) and [Ni(CO) 3 (GaL)] (LC(CH 3 )N(C 6 H 3 -2,6-iPr 2 )] 2 ): Thermal DecompositionC 6 H 3 -2,6-(C 6 H 3 -2,6-iPr 2 ) 2 ) and GaL (L = HC[C(Me)

Serrano, Oracio; Hoppe, Elke; Power, Philip P.

2010-01-01T23:59:59.000Z

146

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) 3(2250) IG (JPC ) = 1+(3 --)  

E-Print Network [OSTI]

, limits, etc. · · · 2232 HASAN 94 RVUE p p 2090 1 OAKDEN 94 RVUE 0.36­1.55 pp 2250 2 MARTIN 80B HASAN 94 RVUE p p 60 10 OAKDEN 94 RVUE 0.36­1.55 pp 250 11 MARTIN 80B RVUE 200 11 MARTIN 80C RVUE.) ANISOVICH 00J PL B491 47 A.V. Anisovich et al. KLOET 96 PR D53 6120 W.M. Kloet, F. Myhrer (RUTG, NORD) HASAN

147

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f0(2330) IG (JPC ) = 0+(0 + +)  

E-Print Network [OSTI]

, limits, etc. · · · 2314±25 1 BUGG 04A RVUE 2337±14 ANISOVICH 00J SPEC 2.0 pp , 2321 HASAN 94 RVUE p p for averages, fits, limits, etc. · · · 144±20 2 BUGG 04A RVUE 217±33 ANISOVICH 00J SPEC 2.0 pp , 223 HASAN.V. Anisovich et al. BARNES 00 PR C62 055203 P.D. Barnes et al. HASAN 94 PL B334 215 A. Hasan, D.V. Bugg (LOQM

148

A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM o  

Office of Legacy Management (LM)

A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM of A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM of metallurKic.%l, fabrication, and nhysicnf stuJles whtch owht to be carried out as lntcnsively as -loseible stnrtinr: imiaedintely, in order to Tmvide information for the desicn of efficient methods of using atomic noxer. This nrescnt memo becomes more snecific in q entionini: lines of vmr!: which the idetholis and iinterlals Section believes to bc of lnortence. It also tells names of neonle and olaces where useful eouinment is available. The stu;lies may be divided into 5 mats: .:. .,.. I. Phases of tiec1a.l Metals end Their tiloys II. Fahrlcntion III. corrosion IV. Heat Transfer and Fluid Flow 7. Snecial 'Jhysical Tests I. Phases of Soecial Hetale and Their Alloys (Written by E. Creutz and 3. &wine@)

149

Electronic self-organization in the single-layer manganite $\\rm Pr_{1-x}Ca_{1+x}MnO4$  

SciTech Connect (OSTI)

We use neutron scattering to investigate the doping evolution of the magnetic correlations in the single-layer manganite $\\rm Pr_{\\it 1-x}Ca_{\\it 1+x}MnO_4$, away from the $x=0.5$ composition where the CE-type commensurate antiferromagnetic (AF) structure is stable. We find that short-range incommensurate spin correlations develop as the system is electron doped ($x<0.5$), which coexist with the CE-type AF order. This suggests that electron doping in this system induces an inhomogeneous electronic self-organization, where commensurate AF patches with $x=0.5$ are separated by electron-rich domain walls with short range magnetic correlations. This behavior is strikingly different than for the three-dimensional $\\rm Pr_{\\it 1-x}Ca_{\\it x}MnO_3$, where the long-range CE-type commensurate AF structure is stable over a wide range of electron or hole doping around $x=0.5$.

Ye, Feng [ORNL; Chi, Songxue [ORNL; Fernandez-Baca, Jaime A [ORNL; Moreo, Adriana [ORNL; Dagotto, Elbio R [ORNL; Lynn, J. W. [National Institute of Standards and Technology (NIST); Mathieu, R. [Spin Superstructure Project, ERATO, Japan Science and Technology, Tsukuba 305-85; Kaneko, Y. [Spin Superstructure Project, ERATO, Japan Science and Technology, Tsukuba 305-85; Tokura, Y. [University of Tokyo, Tokyo, Japan; Dai, Pengcheng [ORNL

2009-01-01T23:59:59.000Z

150

Structural and magnetic properties of mechanically milled Y{sub 1-x}Pr {sub x}Co{sub 5} compounds [x = 0, 0.1, 0.3, 0.5  

SciTech Connect (OSTI)

Samples of composition Y{sub 1-x}Pr {sub x}Co{sub 5} (x = 0, 0.1, 0.3, 0.5) were arc melted in an argon atmosphere, mechanically milled for various times and heat treated at about 1073 K for short periods of time, in order to obtain nanocrystalline compounds. The X-ray diffraction patterns after the heat treatment indicated a single hexagonal 1:5 phase for each composition. The unit cell parameters varied with Pr content in the Y{sub 1-x}Pr {sub x}Co{sub 5} series. The crystallite size determined from transmission electron micrographs was about 13 nm. The intrinsic coercivity increased with Pr content; a maximum coercivity of 1.17 MA/m and an enhanced relative remanence magnetization to maximum magnetization ratio {sigma} {sub r}/{sigma} {sub max} = 0.71 were achieved after heat treatment for the composition Y{sub 0.5}Pr{sub 0.5}Co{sub 5}. The enhanced magnetic properties suggest strong intergranular exchange coupling in this composition, consistent with the very fine crystallite size.

Elizalde Galindo, J.T. [Department of Physics, University of Texas at El Paso, 500 W. University Avenue, El Paso, TX 79968, (United States)]. E-mail: jose.elizalde.galindo@gmail.com; Davies, H.A. [Department of Engineering Materials, University of Sheffield, Sir Robert Hadfield Building, Mappin Street, Sheffield, S1 3JD (United Kingdom)]. E-mail: h.a.davies@sheffield.ac.uk; Matutes-Aquino, J.A. [Centro de Investigacion en Materiales Avanzados, S.C (CIMAV), Miguel de Cervantes 120, Chihuahua, Chih., 31109 (Mexico)]. E-mail: jose.matutes@cimav.edu.mx

2007-08-15T23:59:59.000Z

151

Anisotropic magnetoresistance of epitaxial Pr{sub 0.5}Sr{sub 0.5}MnO{sub 3} film  

SciTech Connect (OSTI)

The magnetic field and temperature dependent anisotropic magnetoresistance (AMR) of the epitaxial grown Pr{sub 0.5}Sr{sub 0.5}MnO{sub 3} thin films was investigated. It was found that the magnetoresistance exhibited the characteristics of magnetic polaron hopping. A two-fold symmetric AMR occurred in the ferromagnetic region (?220?K?

Chen, X. G.; Yang, Y. B.; Wang, C. S.; Liu, S. Q.; Zhang, Y.; Han, J. Z.; Yang, Y. C. [State Key Laboratory of Mesoscopic Physics, and School of Physics, Peking University, Beijing 100871 (China); Yang, J. B., E-mail: jbyang@pku.edu.cn [State Key Laboratory of Mesoscopic Physics, and School of Physics, Peking University, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, Beijing 100871 (China)

2014-01-28T23:59:59.000Z

152

Impact of oxygen annealing on the heat capacity and magnetic resonance of superconducting Pr0.88LaCe0.12CuO4?  

SciTech Connect (OSTI)

We use thermodynamic and neutron-scattering measurements to study the effect of oxygen annealing on the superconductivity and magnetism in Pr0.88LaCe0.12CuO4?. Although the transition temperature Tc measured by susceptibility and superconducting coherence length increases smoothly with gradual oxygen removal from the annealing process, bulk superconductivity, marked by a specific-heat anomaly at Tc and the presence of a neutron magnetic resonance, only appears abruptly when Tc is close to the largest value. These results suggest that the effect of oxygen annealing must first be determined in order to establish a Ce doping dependence of antiferromagnetism and superconductivity phase diagram for electron-doped copper oxides.

Li, Shiliang [University of Tennessee, Knoxville (UTK); Chi, Songxue [University of Tennessee, Knoxville (UTK); Zhao, Jun [ORNL; Wen, H. H. [Chinese Academy of Sciences; Stone, Matthew B [ORNL; Lynn, J. W. [National Institute of Standards and Technology (NIST); Dai, Pengcheng [ORNL

2008-01-01T23:59:59.000Z

153

Effect of antiferromagnetic spin correlations on lattice distortion and charge ordering in Pr0.5Ca1.5MnO4  

SciTech Connect (OSTI)

We use neutron scattering to study the lattice and magnetic structure of the layered half-doped manganite Pr0.5Ca1.5MnO4. On cooling from high temperature, the system first becomes chargeand orbital-ordered (CO/OO) near TCO = 300 K and then develops checkerboard-like antiferromagnetic (AF) order below TN = 130 K. At temperatures above TN but below TCO (TN

Chi, Songxue [ORNL; Ye, Feng [ORNL; Dai, Pengcheng [ORNL; Fernandez-Baca, Jaime A [ORNL; Huang, Q. [National Institute of Standards and Technology (NIST); Lynn, J. W. [National Institute of Standards and Technology (NIST); Plummer, E Ward [ORNL; Mathieu, R. [Spin Superstructure Project, ERATO, Japan Science and Technology, Tsukuba 305-85; Kaneko, Y. [Spin Superstructure Project, ERATO, Japan Science and Technology, Tsukuba 305-85; Tokura, Y. [University of Tokyo, Tokyo, Japan

2007-01-01T23:59:59.000Z

154

Colossal Electroresistive Properties Of CSD Grown Pr{sub 0.7}Ca{sub 0.3}MnO{sub 3} Films For Nonvolatile Memory Applications  

SciTech Connect (OSTI)

Colossal electroresistance effects upon application of electric field in perovskite oxide Pr{sub 0.7}Ca{sub 0.3}MnO{sub 3}(PCMO) thin films, which is a promising candidate for resistance random access memory (RRAM) device have been investigated. Nanocrystalline PCMO films were grown on SiO{sub 2} substrates by chemical solution deposition and crystallized at 700 deg. C under different gas atmospheres. Four terminal current voltage characteristics of Ag/PCMO/Ag planar geometry exhibited a sharp transition from a low resistance state (LRS) to a high resistance state (HRS) with a resistance switching ratio of as high as 1100% at room temperature. Nonvolatility and high retention was confirmed by electric pulse induced resistive switching measurements. The resistance switching ratios were found to depend on the annealing conditions, suggesting an interaction between the nonlattice oxygen and oxygen vacancies and/or the cationic vacancy.

Bhavsar, K. H.; Joshi, U. S. [Department of Physics, University School of Sciences, Gujarat University, Ahmedabad-380 009 (India)

2010-12-01T23:59:59.000Z

155

The series RE5Li2Sn7 (RE = Ce, Pr, Nd, Sm) revisited: crystal structure of RE5Li2-xSn7+x [0 x 0.03 (1)  

Science Journals Connector (OSTI)

Polar intermetallic phases with complex structures are reported in the RE-Li-Sn system (RE = Ce, Pr, Nd, Sm). They crystallize in the chiral orthorhombic space group P212121 (No. 19), which is relatively uncommon among intermetallic phases.

Makongo, J.P.A.

2013-12-07T23:59:59.000Z

156

EU promises new biofuel rules won't harm the environment http://www.pr-inside.com/eu-promises-new-biofuel-rules-won-t-r385258.htm 1 of 2 1/16/2008 12:32 PM  

E-Print Network [OSTI]

EU promises new biofuel rules won't harm the environment http://www.pr-inside.com/eu-promises-new-biofuel promises new biofuel rules won't harm the environment © AP 2008-01-14 16:21:49 - BRUSSELS, Belgium (AP) - The European Union promised Monday that its new push to promote biofuels will try to prevent harming

157

JOURNAL DE PHYSIQUE Colloque C5, supplment au n 5, Tome 40, Mai 1979, page C5-134 Theory of the transition temperature and the magnetization in Pr3Tl under  

E-Print Network [OSTI]

with increasing pressure. The first neutron scattering study of the magnetic exciton dynamics in the singlet is clearly quite substantial. Because of the fluctuations a smaller J(0) can sustain ordering. Recent neutron scattering measurements [3] of the exciton dispersion of (Pr,-,La,),Tl with c = 0, 0.07 and 0.12 shows

Boyer, Edmond

158

Neutron Scattering Studies on Magnetism and Phonon in the Electron-doped Nd2-xCexCuO4 and Pr1-xLaCexCuO4.  

E-Print Network [OSTI]

??We present comprehensive neutron scattering studies on the electron-doped superconductors Nd2-xCexCuO4 and Pr1-xLaCexCuO4 to understand how magnetic properties and phonon are related to superconductivity. For (more)

Kang, Hye Jung

2005-01-01T23:59:59.000Z

159

The molecular structure of PrI3 and GdI3 as determined by synchronous gas-phase electron diffraction and mass spectrometric experiment assisted by quantum chemical calculations  

Science Journals Connector (OSTI)

A gas electron diffraction study of PrI3 and GdI3 has been carried out in combination with mass spectrometric vapour monitoring at 1110(10)K and 1100(10)K, respectively. Up to 3mol.% of dimeric species was obs...

Nina I. Giricheva; Sergey A. Shlykov; Elena A. Lapykina

2011-04-01T23:59:59.000Z

160

Studies on the Stability of a La0.8Pr0.2NiAl11O19 Catalyst for Syngas Production by CO2 Reforming of Methane  

Science Journals Connector (OSTI)

CO2 reforming of CH4 was studied over a magnetoplumbite-type hexaaluminate La0.8Pr0.2NiAl11O19 catalyst, which showed very high activity for over 300 h without deactivation at 1023 K. This catalyst showed good re...

Yan Liu; Tiexin Cheng; Dongmei Li; Pengbo Jiang; Junxia Wang

2003-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

A Spirit Level to Be Fixed to a Quadrant for Taking a Meridional Altitude at Sea, When the Horizon is Not Visible. By John Hadley, Esq; V. Pr. R. S.  

Science Journals Connector (OSTI)

...Fixed to a Quadrant for Taking a Meridional Altitude at Sea, When the Horizon is Not Visible. By John Hadley, Esq; V. Pr. R. S. John Hadley The Royal Society is collaborating with JSTOR to digitize, preserve, and extend access to Philosophical...

1733-01-01T23:59:59.000Z

162

EXAFS study of intermetallics of the type RGe2 (R=La, Ce, Pr, Nd, Sm, Gd, Tb, Dy, Ho, Er and Y) Part I: Determination of Ge-Ge distances  

Science Journals Connector (OSTI)

A study of theEXAFS associated with theK x-ray absorption discontinuity of germanium in pure germanium and in the rare-earth germanides RGe2...(where R=La, Ce, Pr, Nd, Sm, Gd, Tb, Dy, Ho, Er and Y) has been carri...

A R Chourasia; V D Chafekar; S D Deshpande; C Mande

1985-05-01T23:59:59.000Z

163

Data:82153c86-4996-4b06-b372-b6e1c0bcb1a3 | Open Energy Information  

Open Energy Info (EERE)

4996-4b06-b372-b6e1c0bcb1a3 4996-4b06-b372-b6e1c0bcb1a3 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mid-Kansas Electric Company, LLC (MKEC) Effective date: 2010/01/14 End date if known: Rate name: General Service Small-Heating Service(30% of the Load or more) Sector: Commercial Description: Entire Service Area. To all electric service of a single character supplied at one point of delivery and used for general business or commercial purposes. Where the the customer has installed and in regular use electric space heating that is not less than 30% of the total connected load,the demand used for billing purposes in the billing months of November 1 through June 30 shall not exceed the highest similarly established in the next preceding billing months of July, August,September, or October.

164

Data:D2c86fec-dd50-4485-b638-365a79d904b8 | Open Energy Information  

Open Energy Info (EERE)

fec-dd50-4485-b638-365a79d904b8 fec-dd50-4485-b638-365a79d904b8 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Eagle River, Wisconsin (Utility Company) Effective date: 2009/08/04 End date if known: Rate name: Rg-2 Residential Service Single Phase - Optional Time-of-Day 8am-8pm Sector: Residential Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base

165

Data:C86f705a-e082-49e4-9622-df4009777a6a | Open Energy Information  

Open Energy Info (EERE)

5a-e082-49e4-9622-df4009777a6a 5a-e082-49e4-9622-df4009777a6a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Williams - AZ, Arizona (Utility Company) Effective date: 2013/04/01 End date if known: Rate name: Customer owned Lights(20,000 Lumens 400 W MV-Pole) Sector: Commercial Description: Source or reference: Rate Binder#4 (Illinois State University) Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

166

Data:C86e738f-76dc-4017-8438-9c27ee94a81f | Open Energy Information  

Open Energy Info (EERE)

8f-76dc-4017-8438-9c27ee94a81f 8f-76dc-4017-8438-9c27ee94a81f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Cotton Electric Coop, Inc Effective date: 2010/02/01 End date if known: Rate name: Commercial Time -Of- Use Service-Single Phase Sector: Commercial Description: * Available for commercial customers up to 50 kVA of transformer capacity. Further capacity available at the discretion of the Cooperative, up to 150 kVA. Subject to power cost adjustment and tax adjustment on-Peak period is June 20 through September 9, from 4p.m to 8p.m Source or reference: ISU Documentation Rate Binder Kelly # 4

167

Data:58c86e88-9e30-4f65-bdff-6272a8b65832 | Open Energy Information  

Open Energy Info (EERE)

6e88-9e30-4f65-bdff-6272a8b65832 6e88-9e30-4f65-bdff-6272a8b65832 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Sawnee Electric Membership Corporation Effective date: 2012/06/01 End date if known: Rate name: Outdoor Lighting Cobrahead/Ornamental MH 1000 W Sector: Lighting Description: *Wood Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $600 per 30 foot wood pole, ii. $625 per 35 foot wood pole, Standard Ornamental Fixtures and Standard Ornamental Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $ 525 per 22 foot fiberglass pole; ii. $1,450 per 35 foot fiberglass pole;

168

Data:7bf5e9e4-7305-4ca8-9c86-ed6f78eebb78 | Open Energy Information  

Open Energy Info (EERE)

Effective date: 20120915 End date if known: Rate name: Large Power Time-of-Day Service Cp-3 Option A Sector: Industrial Description: This rate will be applied to customers for...

169

[McC86] John McCarthy. Application of circumscription to formaliz ing commonsense knowledge. Artificial Intelligence, 28:89--116,  

E-Print Network [OSTI]

:365--385, 1991. [GM92] John Grant and Jack Minker. Deductive database systems. In Stuart C. Shapiro, editor C. Shapiro, editor, Encyclopedia of Artificial Intelligence, pages 873-- 891. John Wiley & Sons, 2nd. Constraint networks. In Stuart C. Shapiro, edi­ tor, Encyclopedia of Artificial Intelligence, pages 276

Dechter, Rina

170

Data:5f841b3b-6c9a-431c-86c8-072ef7fde0eb | Open Energy Information  

Open Energy Info (EERE)

0318 End date if known: Rate name: VILLAGE RESIDENTIAL SERVICE - Up to 37.5 KVA transformer Sector: Residential Description: Source or reference: http:www.wildriceelectric.c...

171

The extended chain compounds Ln {sub 12}(C{sub 2}){sub 3}I{sub 17} (Ln=Pr, Nd, Gd, Dy): Synthesis, structure and physical properties  

SciTech Connect (OSTI)

The title compounds are obtained in high yield from stoichiometric mixtures of Ln, LnI{sub 3} and graphite, heated at 900-950 deg. C in welded Ta containers. The crystal structures of new Pr and Nd phases determined by single-crystal X-ray diffraction are related to those of other Ln {sub 12}(C{sub 2}){sub 3}I{sub 17}-type compounds (C 2/c, a=19.610(1) and 19.574(4) A, b=12.406(2) and 12.393(3) A, c=19.062(5) and 19.003(5) A, {beta}=90.45(3){sup o} and 90.41(3){sup o}, for Pr{sub 12}(C{sub 2}){sub 3}I{sub 17} and Nd{sub 12}(C{sub 2}){sub 3}I{sub 17}, respectively). All compounds contain infinite zigzag chains of C{sub 2}-centered metal atom octahedra condensed by edge-sharing into the [tcc] {sub {infinity}} sequence (c=cis, t=trans) and surrounded by edge-bridging iodine atoms as well as by apical iodine atoms that bridge between chains. The polycrystalline Gd{sub 12}(C{sub 2}){sub 3}I{sub 17} sample exhibits semiconducting thermal behavior which is consistent with an ionic formulation (Ln {sup 3+}){sub 12}(C{sub 2} {sup 6-}){sub 3}(I{sup -}){sub 17}(e{sup -}) under the assumption that one extra electron is localized in metal-metal bonding. The magnetization measurements on Nd{sub 12}(C{sub 2}){sub 3}I{sub 17}, Gd{sub 12}(C{sub 2}){sub 3}I{sub 17} and Dy{sub 12}(C{sub 2}){sub 3}I{sub 17} indicate the coexistence of competing magnetic interactions leading to spin freezing at T {sub f}=5 K for the Gd phase. The Nd and Dy compounds order antiferromagnetically at T {sub N}=25 and 29 K, respectively. For Dy{sub 12}(C{sub 2}){sub 3}I{sub 17}, a metamagnetic transition is observed at a critical magnetic field H{approx}25 kOe. - Graphical abstract: Zigzag chains of edge-sharing metal atom octahedra in Ln {sub 12}(C{sub 2}){sub 3}I{sub 17}.

Ryazanov, Mikhail [Max-Planck-Institut fuer Festkoerperforschung, Heisenbergstr. 1, D-70569 Stuttgart (Germany); Mattausch, Hansjuergen [Max-Planck-Institut fuer Festkoerperforschung, Heisenbergstr. 1, D-70569 Stuttgart (Germany); Simon, Arndt [Max-Planck-Institut fuer Festkoerperforschung, Heisenbergstr. 1, D-70569 Stuttgart (Germany)], E-mail: A.Simon@fkf.mpg.de

2007-04-15T23:59:59.000Z

172

Ultrafast terahertz-induced response of GeSbTe phase-change materials Michael J. Shu,1,2,a)  

E-Print Network [OSTI]

Ultrafast terahertz-induced response of GeSbTe phase-change materials Michael J. Shu,1,2,a) Peter-optically, pumping with single-cycle terahertz pulses as a means of biasing phase-change materials on a sub of these materials is important for predicting the field-driven heating and phase-change behavior. However

173

[Ta{sub 6}Cl{sub 12}(PrCN){sub 6}][(Ta{sub 6}Cl{sub 12})Cl{sub 6}]{center{underscore}dot}2PrCn, a compound with homonuclear mixed-charge cluster units [Ta{sub 6}Cl{sub 12}]{sup 2+} and [Ta{sub 6}Cl{sub 12}]{sup 4+}  

SciTech Connect (OSTI)

In transition metal cluster chemistry, compounds consisting of both a cluster cation and a cluster anion are not very common. The first members of this type of compound of the composition [M{sub 6}X{sub 12}(EtOH){sub 6}][(Mo{sub 6}Cl{sub 8})Cl{sub 4}X{sub 2}]{center{underscore}dot}mEtOH{center{underscore}dot}nEt{sub 2}O (M = Nb, Ta; X = Cl, Br) have been recently prepared. Crystal structure determinations for [Nb{sub 6}Cl{sub 12}(EtOH){sub 6}][(Mo{sub 6}Cl{sub 8})Cl{sub 6}]{center{underscore}dot}3EtOH{center{underscore}dot}3Et{sub 2}O and [Ta{sub 6}Cl{sub 12}(EtOH){sub 6}][(Mo{sub 6}Cl{sub 8})Cl{sub 6}]{center{underscore}dot}6EtOH revealed the presence of two different hexanuclear cluster cores; namely, the [M{sub 6}X{sub 12}(EtOH){sub 6}]{sup 2+} cluster cations and the [(Mo{sub 6}Cl{sub 8})Cl{sub 4}X{sub 2}]{sup 2{minus}} cluster anions. In fact, these compounds consist of two different heteronuclear cluster units with different charges: [M{sub 6}X{sub 12}]{sup 2+} in the cation and [Mo{sub 6}Cl{sub 8}]{sup 4+} in the anion. The preparation of cation-anion pairs with homonuclear mixed-charge cluster units is also possible. In the present study, the synthesis and crystal structure of the cluster pair [Ta{sub 6}Cl{sub 12}(PrCN){sub 6}][(Ta{sub 6}Cl{sub 12})Cl{sub 6}]{center{underscore}dot}2PrCN is reported. The compound is built of two octahedral homonuclear mixed-charge cluster units: [Ta{sub 6}Cl{sub 12}]{sup 2+} in the [Ta{sub 6}Cl{sub 12}(PrCN){sub 6}]{sup 2+} cluster cation and [Ta{sub 6}Cl{sub 12}]{sup 4+} in the [(Ta{sub 6}Cl{sub 12})Cl{sub 6}]{sup 2{minus}} cluster anion.

Brnicevic, N.; Sirac, S.; Basic, I.; Zhang, Z.; McCarley, R.E.; Guzei, I.A.

1999-09-06T23:59:59.000Z

174

Glass-like recovery of antiferromagnetic spin ordering in a photo-excited manganite Pr0.7Ca0.3MnO3  

SciTech Connect (OSTI)

Electronic orderings of charges, orbitals and spins are observed in many strongly correlated electron materials, and revealing their dynamics is a critical step toward understanding the underlying physics of important emergent phenomena. Here we use time-resolved resonant soft x-ray scattering spectroscopy to probe the dynamics of antiferromagnetic spin ordering in the manganite Pr0:7Ca0:3MnO3 following ultrafast photo-exitation. Our studies reveal a glass-like recovery of the spin ordering and a crossover in the dimensionality of the restoring interaction from quasi-1D at low pump fluence to 3D at high pump fluence. This behavior arises from the metastable state created by photo-excitation, a state characterized by spin disordered metallic droplets within the larger charge- and spin-ordered insulating domains. Comparison with time-resolved resistivity measurements suggests that the collapse of spin ordering is correlated with the insulator-to-metal transition, but the recovery of the insulating phase does not depend on the re-establishment of the spin ordering.

Zhou, S.Y.; Langner, M.C.; Zhu, Y.; Chuang, Y.-D.; Rini, M.; Glover, T.E.; Hertlein, M.P.; Gonzalez, A.G. Cruz; Tahir, N.; Tomioka, Y.; Tokura, Y.; Hussain, Z.; Schoenlein, R.W.

2014-01-16T23:59:59.000Z

175

Data:B04aa56c-12a5-43dc-86dd-3355e2a5cd72 | Open Energy Information  

Open Energy Info (EERE)

6c-12a5-43dc-86dd-3355e2a5cd72 6c-12a5-43dc-86dd-3355e2a5cd72 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Wild Rice Electric Coop, Inc Effective date: 2012/03/18 End date if known: Rate name: FARM AND HOME SERVICE - Up to 15 KVA transformer Sector: Residential Description: Source or reference: http://www.wildriceelectric.com/b-rate.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

176

Data:7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 | Open Energy Information  

Open Energy Info (EERE)

7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Moorhead, Minnesota (Utility Company) Effective date: End date if known: Rate name: Small General Service/General Service: Dual-Fuel Sector: Commercial Description: Available to Small General Service and General Service customers in conformance with Moorhead Public Service' Source or reference: http://www.mpsutility.com/images/stories/rates/2013/Electric%20Rates.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh)

177

Data:B04adc72-6615-4040-901d-e4a8b12a0385 | Open Energy Information  

Open Energy Info (EERE)

2-6615-4040-901d-e4a8b12a0385 2-6615-4040-901d-e4a8b12a0385 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Johnson City, Tennessee (Utility Company) Effective date: 2012/08/01 End date if known: Rate name: STREET LIGHTING Sector: Lighting Description: Source or reference: http://www.jcpb.com/yourBusiness/meters/rates.asp#rateSheet Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

178

Data:D5afa075-e887-4728-97a1-2a2bc811845d | Open Energy Information  

Open Energy Info (EERE)

afa075-e887-4728-97a1-2a2bc811845d afa075-e887-4728-97a1-2a2bc811845d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Rochester Public Utilities Effective date: 2009/01/01 End date if known: Rate name: SECURITY LIGHTING(250 Watt HPS) Sector: Lighting Description: At all locations whenever the service can be provided with overhead wiring on an existing RPU owned pole. Source or reference: http://www.rpu.org/documents/2012_rate_schedule.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage

179

Data:Ad262f27-c738-4d12-a3a0-0c0b5f53221a | Open Energy Information  

Open Energy Info (EERE)

62f27-c738-4d12-a3a0-0c0b5f53221a 62f27-c738-4d12-a3a0-0c0b5f53221a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Singing River Elec Pwr Assn (Mississippi) Effective date: 2009/12/04 End date if known: Rate name: Security Lighting MV 175 W Post Top (Includes Pole) Sector: Lighting Description: *Subject to power cost adjustment, tax expense adjustment, and an environmental compliance charge. Source or reference: http://www.singingriver.com/Files/R-18.pdf Source Parent: Comments Energy Adjustment is Power Cost Adjustment plus Environmental Clause plus Regulatory Adjustment Applicability Demand (kW)

180

Data:F1983099-90dc-4b12-a937-bc3c29638f2d | Open Energy Information  

Open Energy Info (EERE)

99-90dc-4b12-a937-bc3c29638f2d 99-90dc-4b12-a937-bc3c29638f2d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mt Carmel Public Utility Co Effective date: End date if known: Rate name: Residential Sector: Residential Description: AVAILABILITY Available for any customer for Company's standard service for residential purposes. Where a residence and business are combined in one premise, the service classification shall be determined by the predominant electric use at the premise. Source or reference: http://www.mtcpu.com/includes/tariff_electric.htm?t=Residential_Electric_Service Source Parent:

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Data:Dd3d2c12-a21e-43ef-a56f-eec753ee1976 | Open Energy Information  

Open Energy Info (EERE)

c12-a21e-43ef-a56f-eec753ee1976 c12-a21e-43ef-a56f-eec753ee1976 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Choctaw Electric Coop Inc Effective date: 2008/10/21 End date if known: Rate name: Choctaw Nation Senior Citizens Center Sector: Commercial Description: * Available to the Choctaw Nation for multi-building complexes having electric space heating where more than one building is served from a single transformer. Electric service shall be billed to and paid by the Choctaw Nation on one monthly bill. Subject to Tax Adjustment. Source or reference: Rate binder # 4 Source Parent: Comments

182

Data:1eed3a36-f12a-4353-b92b-d5c5c0281e45 | Open Energy Information  

Open Energy Info (EERE)

eed3a36-f12a-4353-b92b-d5c5c0281e45 eed3a36-f12a-4353-b92b-d5c5c0281e45 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Three Notch Elec Member Corp Effective date: 2012/03/01 End date if known: Rate name: 175 Mercury vapor with Underground Wiring- (Type - 'MV-Open', Fiberglass Pole) Sector: Lighting Description: Applicable only for dusk to dawn lighting by means of photo-electric controlled, ballast operated vapor lamp luminaries and poles conforming to the Cooperative's specifications. Service will be rendered only at locations that, solely in the opinion of the Cooperative, are readily accessible for installation and maintenance.

183

PR_VI_50mwind  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Metadata also available as Metadata: IdentificationInformation DataQualityInformation SpatialDataOrganizationInformation SpatialReferenceInformation EntityandAttributeI...

184

Investigation of the ultrasonic wave influence on magnetic ordering in a 20 x [Fe(20 A)/Cr(12 A)]/MgO layered structure  

SciTech Connect (OSTI)

A 20 x [Fe(20 A)/Cr (12 A)]/MgO structure excited by an ultrasonic wave was investigated by polarized neutron reflectometry. It was found that magnetic domains oscillate and their effective size decreases in weak magnetic fields. In close-to-saturation fields, a magnetic lattice is formed in the layered structure; the interplanar spacings in this lattice change with an increase in the field strength and as a result of the excitation of the structure by an ultrasonic wave.

Aksenov, V. L.; Nikitenko, Yu. V.; Proglyado, V. V.; Khaidukov, Yu. N., E-mail: khaiduk@nf.jinr.ru [Joint Institute for Nuclear Research (Russian Federation); Gavrilov, V. N.; Raitman, E. [Institute of Physical Energetics (Latvia); Bottyan, L.; Nagy, D. L. [Research Institute for Particle and Nuclear Physics (Hungary)

2008-09-15T23:59:59.000Z

185

c12a.xls  

Gasoline and Diesel Fuel Update (EIA)

1,522 3,228 1,772 18,031 33,384 20,243 84.4 96.7 87.6 Building Floorspace (Square Feet) 1,001 to 5,000 ................................. 193 300 193 2,168 2,904 1,850 89.0 103.2 104.2 5,001 to 10,000 ............................... 134 263 165 2,032 3,217 1,784 66.0 81.9 92.5 10,001 to 25,000 ............................. 241 432 226 3,273 5,679 3,707 73.6 76.1 60.9 25,001 to 50,000 ............................. 181 370 191 2,517 4,518 2,347 71.8 81.8 81.5 50,001 to 100,000 ............................ 156 473 285 2,095 4,763 3,433 74.3 99.3 82.9 100,001 to 200,000 .......................... 219 523 323 2,161 4,706 3,350 101.1 111.1 96.5 200,001 to 500,000 .......................... 221 371 160 2,179 3,623 1,692 101.4 102.3 94.3 Over 500,000 ................................... 179 497 Q 1,606 3,974 2,080 111.2 125.0 Q Principal Building Activity

186

Data:Bb1cc354-27f0-4e38-a12a-449df422b2f6 | Open Energy Information  

Open Energy Info (EERE)

cc354-27f0-4e38-a12a-449df422b2f6 cc354-27f0-4e38-a12a-449df422b2f6 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Miami-Cass County Rural E M C Effective date: 2011/10/01 End date if known: Rate name: Security Lights Metered 250 watt high pressure sodium Sector: Lighting Description: The Miami-Cass County Rural Electric Membership Corporation (REMC) shall charge and collect for security lighting service on the following bases of availability, character of service, monthly rate, and tax adjustment. AVAILABILITY: Available to any member of the REMC for continuous year round service for outdoor lighting where 120 volt service exists ahead of the meter loop.

187

Data:37cfd1b4-12a3-480f-ba5b-79db36229eec | Open Energy Information  

Open Energy Info (EERE)

cfd1b4-12a3-480f-ba5b-79db36229eec cfd1b4-12a3-480f-ba5b-79db36229eec No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Groton, South Dakota (Utility Company) Effective date: End date if known: Rate name: Schedule C - HEAT METER Geothermal/Heat Pump Rates Sector: Residential Description: #2 Heat Meter - All kwh at $.08 per kwh Minimum 10 kw resistance backup. Source or reference: http://city.grotonsd.gov/electric.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V):

188

Data:0c7149ef-adf6-42a7-963d-4b12a98d024d | Open Energy Information  

Open Energy Info (EERE)

ef-adf6-42a7-963d-4b12a98d024d ef-adf6-42a7-963d-4b12a98d024d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Duke Energy Ohio Inc Effective date: 2013/05/06 End date if known: Rate name: Rate OL - Outdoor Lighting Service - MV 400 Watts Sector: Lighting Description: Applicable for outdoor lighting services on private property with Company owned fixtures in the Company's entire service area where secondary distribution lines are adjacent to the premises to be served. Not applicable for lighting public roadways which are dedicated, or anticipated to be dedicated, except to meet the occasional singular need of a customer who has obtained written approval from the proper governmental authority.

189

Data:638bc389-fb01-4b31-96a5-0c12a8e0261b | Open Energy Information  

Open Energy Info (EERE)

bc389-fb01-4b31-96a5-0c12a8e0261b bc389-fb01-4b31-96a5-0c12a8e0261b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nevada Power Co Effective date: 2013/01/01 End date if known: Rate name: OLGS-1-TOU (Large General Service Time-Of-Use) Sector: Commercial Description: Optional for non-Domestic Service where consumption of energy exceeds 3,500 kWh in any one month, where the Billing Demand is equal to or less than 299 kW in any one month and where time-of-use pricing is requested by the Customer. All service will be supplied at one Point of Delivery and measured through one kilowatthour Meter. Not applicable to standby, resale, temporary, shared, or mixed class of service. Not applicable to supplemental service unless the Customer is a Qualifying Facility under Title 18, Code of Federal Regulations, Section 292.201 through 292.207. This schedule is limited to the addition of 1,000 new Customers per month on all optional time-of-use schedules.

190

Data:Eac1dd3a-0268-4e5c-b1d1-ed9feeb2a12a | Open Energy Information  

Open Energy Info (EERE)

dd3a-0268-4e5c-b1d1-ed9feeb2a12a dd3a-0268-4e5c-b1d1-ed9feeb2a12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Ameren Illinois Company Effective date: 2010/11/19 End date if known: Rate name: DS-2 and BGS-2 Zone 2 - Bundled Small General Delivery Service 600V or Less Sector: Commercial Description: AVAILABILITY Service under this Rate is available for any eligible Non-Residential Customer within the territory served by Company that meets the following criteria: Customers served under this Rate shall have a maximum monthly Demand of less than 150 kilowatts (kW) as qualified in the Delivery Service Rate Reassignment section. A Customer without a demand meter installed, but with an average usage of less than 1,200 kWh per day during each monthly billing period will be normally assumed to have a maximum monthly Demand of less than 150 kW. Where Customer's average daily usage is 1,200 kWh per day or more in any monthly billing period, Company may install a demand meter at Company's expense to determine if Customer remains eligible for service under this Rate.

191

Data:4bb12a66-235d-4b62-8af0-1e344385ee34 | Open Energy Information  

Open Energy Info (EERE)

4bb12a66-235d-4b62-8af0-1e344385ee34 4bb12a66-235d-4b62-8af0-1e344385ee34 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tri-County Electric Coop, Inc (Florida) Effective date: End date if known: Rate name: Outdoor Lighting MHF 400 W Sector: Lighting Description: Source or reference: http://www.tcec.com/myBusiness/resSinglePhase.aspx Source Parent: http://www.tcec.com/ Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

192

Data:8100a82f-3ccb-4ce5-b6dc-12a267a595c1 | Open Energy Information  

Open Energy Info (EERE)

0a82f-3ccb-4ce5-b6dc-12a267a595c1 0a82f-3ccb-4ce5-b6dc-12a267a595c1 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Wahoo, Nebraska (Utility Company) Effective date: 2012/02/01 End date if known: Rate name: Industrial Large General Service (Three Phase) Sector: Industrial Description: Source or reference: http://www.wahoo.ne.us/content_subcat.asp?SubCategoryID=88&CategoryID=125&ContentID=68 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V):

193

Data:5820ba98-12a4-4dd7-a83b-c3350ad462a2 | Open Energy Information  

Open Energy Info (EERE)

ba98-12a4-4dd7-a83b-c3350ad462a2 ba98-12a4-4dd7-a83b-c3350ad462a2 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Orange & Rockland Utils Inc Effective date: 2012/04/01 End date if known: Rate name: SC16 Street Lighting Induction Overhead and Underground 70w (Customer owned, retail service, multiple bills) Sector: Description: APPLICABLE TO USE OF SERVICE FOR: Sales and delivery of electric power supply provided by the Company or delivery of electric power supply provided by an Energy Service Company under the Company's Retail Access Program for outdoor lighting of areas, beyond the limits of public streets, highways or roadways, for use of individuals and private or public organizations where existing distribution facilities are suitable for the service requested.

194

Data:420fb714-7054-49c9-8b1f-f07dac56b12a | Open Energy Information  

Open Energy Info (EERE)

14-7054-49c9-8b1f-f07dac56b12a 14-7054-49c9-8b1f-f07dac56b12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: KEM Electric Coop Inc Effective date: End date if known: Rate name: Electric Heat Service -7 M Sector: Residential Description: Available to all members under SE-1, where electric heat is the primary source of heating. Service shall be to a single point of service Type of Service Single Phase, 60 cycle, at secondary voltages. The Cooperative will provide meter, meter socket, and C.T. equipment necessary to measure electric usage. Source or reference: http://www.kemelectric.com/Customer_Service/Rate_Schedules/Schedule%20EH-7M/index.html

195

Data:De12a8fe-13b5-4491-9139-ea729b96ec3d | Open Energy Information  

Open Energy Info (EERE)

De12a8fe-13b5-4491-9139-ea729b96ec3d De12a8fe-13b5-4491-9139-ea729b96ec3d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Seattle, Washington (Utility Company) Effective date: 2012/01/01 End date if known: Rate name: Schedule LGB-Large Standard General Service:Burien(First Avenue South 1 Undergrounding Charge) Sector: Commercial Description: SCHEDULE LGS is for standard general service provided to Burien customers whose maximum monthly demand is equal to or greater than 1,000 kW but less than 10,000 kW. Minimum Charge: $34.21 per meter per day. First Avenue South 1 Undergrounding Charge: All kWh at 0.37 cent per kWh

196

Data:Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a | Open Energy Information  

Open Energy Info (EERE)

Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Painesville, Ohio (Utility Company) Effective date: 1990/07/01 End date if known: Rate name: Intersection flasher light-Within Corporate Limits Sector: Lighting Description: For the purpose of paying the expenses of conducting and managing the Electric Division, Utilities Department, of the City, the City Manager is hereby authorized and directed to charge the following rates, for all utility bills issued on and after the dates indicated below. These rates are applicable to service calls, unmetered services, standby power and miscellaneous installations which do not fall under the normal rate schedules, which rates are hereby adopted for all utility bills issued on and after July 1, 1990

197

Data:4f82f0e5-12a3-453d-9fbf-d3583d8e7236 | Open Energy Information  

Open Energy Info (EERE)

2f0e5-12a3-453d-9fbf-d3583d8e7236 2f0e5-12a3-453d-9fbf-d3583d8e7236 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Provo City Corp (Utility Company) Effective date: 2012/06/01 End date if known: Rate name: Private Outdoor Security (Closed Rate) - 250 W MV - Wood Pole Sector: Lighting Description: Source or reference: http://www.provo.org/util.rates_summary.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

198

Data:6f693279-9c83-43fc-8432-a0927c12a5f9 | Open Energy Information  

Open Energy Info (EERE)

9-9c83-43fc-8432-a0927c12a5f9 9-9c83-43fc-8432-a0927c12a5f9 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Kiel, Wisconsin (Utility Company) Effective date: 2011/05/06 End date if known: Rate name: Cp-3 Industrial Power Time-of-Day Service above 600kW Demand 8am-10pm Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0754 per kilowatt-hour.

199

Data:7fb75ac1-2a7e-4b4a-b21e-c51764137a9e | Open Energy Information  

Open Energy Info (EERE)

7fb75ac1-2a7e-4b4a-b21e-c51764137a9e 7fb75ac1-2a7e-4b4a-b21e-c51764137a9e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: New York Power Authority Effective date: 2013/07/01 End date if known: Rate name: SC 68 Conventional (Westchester Customers) Sector: Commercial Description: Source or reference: http://www.nypa.gov/about/documents.htm Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

200

Data:28b54f08-c941-4fd0-93d1-2a577e3dd598 | Open Energy Information  

Open Energy Info (EERE)

8-c941-4fd0-93d1-2a577e3dd598 8-c941-4fd0-93d1-2a577e3dd598 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Puget Sound Energy Inc Effective date: 2013/07/01 End date if known: Rate name: Company Street Lights-120 watt Sector: Lighting Description: Source or reference: http://pse.com/aboutpse/Rates/Documents/elec_sch_053.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Data:19280696-9d1c-44f3-a80a-12a25ad40f31 | Open Energy Information  

Open Energy Info (EERE)

696-9d1c-44f3-a80a-12a25ad40f31 696-9d1c-44f3-a80a-12a25ad40f31 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Orange & Rockland Utils Inc Effective date: 2012/04/01 End date if known: Rate name: SC16 Street Lighting Induction Overhead and Underground 150w (Customer owned, full service, single bill) Sector: Description: APPLICABLE TO USE OF SERVICE FOR: Sales and delivery of electric power supply provided by the Company or delivery of electric power supply provided by an Energy Service Company under the Company's Retail Access Program for outdoor lighting of areas, beyond the limits of public streets, highways or roadways, for use of individuals and private or public organizations where existing distribution facilities are suitable for the service requested.

202

Electronically competing phases and their magnetic field dependence in electron-doped nonsuperconducting and superconducting Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4{+-}}{sub {delta}}  

SciTech Connect (OSTI)

We present comprehensive neutron scattering studies of nonsuperconducting and superconducting electron-doped Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4{+-}}{sub {delta}} (PLCCO). At zero field, the transition from antiferromagnetic (AF) as-grown PLCCO to superconductivity without static antiferromagnetism can be achieved by annealing the sample in pure Ar at different temperatures, which also induces an epitaxial (Pr,La,Ce){sub 2}O{sub 3} phase as an impurity. When the superconductivity first appears in PLCCO, a quasi-two-dimensional (2D) spin-density-wave (SDW) order is also induced, and both coexist with the residual three-dimensional (3D) AF state. A magnetic field applied along the [1,1,0] direction parallel to the CuO{sub 2} plane induces a 'spin-flop' transition, where the noncollinear AF spin structure of PLCCO is transformed into a collinear one. The spin-flop transition is continuous in semiconducting PLCCO, but gradually becomes sharp with increasing doping and the appearance of superconductivity. A c-axis aligned magnetic field that suppresses the superconductivity also enhances the quasi-2D SDW order at (0.5,0.5,0) for underdoped PLCCO. However, there is no effect on the 3D AF order in either superconducting or nonsuperconducting samples. Since the same field along the [1,1,0] direction in the CuO{sub 2} plane has no (or little) effect on the superconductivity (0.5,0.5,0) and (Pr,La,Ce){sub 2}O{sub 3} impurity positions, we conclude that the c-axis field-induced effect is intrinsic to PLCCO and arises from the suppression of superconductivity.

Kang, H.J.; Dai Pengcheng; Mook, H.A.; Argyriou, D.N.; Sikolenko, V.; Lynn, J.W.; Kurita, Y.; Komiya, Seiki; Ando, Yoichi [Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States) and Condensed Matter Sciences Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Condensed Matter Sciences Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Hahn-Meitner-Institut, Glienicker Str 100, Berlin D-14109 (Germany); NIST Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States); Central Research Institute of Electric Power Industry, Komae, Tokyo 201-8511 (Japan)

2005-06-01T23:59:59.000Z

203

Rua: Corao de Maria n 92 Campus Jardim Botnico CEP: 80.210-132 Curitiba/PR Telefone: (41) 3360-4322 Fax (41) 3360-4336 www.pgedf.ufpr.br email: pgedf@ufpr.br  

E-Print Network [OSTI]

Rua: Coração de Maria nº 92 ­ Campus Jardim Botânico ­ CEP: 80.210-132 ­ Curitiba/PR Telefone: (41 de Pós-Graduação em Educação Física - Rua: Coração de Maria nº 92 ­ Campus Jardim Botânico ­ CEP: 80 fotografias 3x4 recentes. Confira o check-list ao final da ficha de inscrição. #12;Rua: Coração de Maria nº 92

Paraná, Universidade Federal do

204

Data:Cb684dd4-12a1-4e54-928a-bf6281e7b00e | Open Energy Information  

Open Energy Info (EERE)

Data Data Edit with form History Facebook icon Twitter icon » Data:Cb684dd4-12a1-4e54-928a-bf6281e7b00e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Sulphur Springs Valley E C Inc Effective date: 2013/03/18 End date if known: Rate name: Street Lighting: 250 Watt MV - Double/Wood Sector: Lighting Description: Customer provided Facilities and Cooperative Owned and Maintained Lighting Service. Source or reference: http://www.ssvec.org/wp-content/uploads/downloads/2013/03/SSVEC-Rates-03.18.13.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW):

205

Pion correlations in 1.8A GeV Ar on KCl and La and 1.2A GeV Xe on La  

Science Journals Connector (OSTI)

Results are presented for pion interferometry measurements of 1.8A GeV Ar+KCl and Ar+La, and 1.2A GeV Xe + La at the Lawrence Berkeley Laboratory Heavy Ion Spectrometer System. The parameters R, ?, ?, R?, and R? are presented for all three projectile-target combinations. The correlation between the extracted size of the pion source and the centrality of the collision is investigated as well as the freeze-out densities and the dependence of the source size on the mean momentum of the pion pairs. The experimental setup and analysis are discussed and comparisons made with the results of others. The phase space covered is at forward angles in the center-of-mass system.

W. B. Christie; W. F. J. Mueller; D. L. Olson; T. J. M. Symons; H. H. Wieman; D. Beavis; F. P. Brady; J. L. Romero; C. E. Tull; T. Abbott; S. Y. Fung; D. Keane; Y. Liu

1992-06-01T23:59:59.000Z

206

Data:E72ee42e-a63e-4795-9893-3ef12a88bed0 | Open Energy Information  

Open Energy Info (EERE)

ee42e-a63e-4795-9893-3ef12a88bed0 ee42e-a63e-4795-9893-3ef12a88bed0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Idaho Power Co Effective date: 2008/03/01 End date if known: Rate name: Schedule 62 - Green energy Purchase Program Rider Sector: Description: PURPOSE The Green Energy Purchase Program is an optional, voluntary program designed to provide customers and non-customer participants an opportunity to participate in the purchase of new environmentally friendly "green" energy. Funds collected in this program will be wholly distributed to the purchase of green energy products. APPLICABILITY Service under this schedule is applicable to all Customers and non-customer participants who choose to participate in this Program. MONTHLY GREEN ENERGY PURCHASE CONTRIBUTION Customers designate their level of participation by choosing a fixed dollar per month amount. The monthly Green Energy Purchase Program contribution is in addition to all other charges included in the service schedule under which the Customer receives electrical service and will be added to the Customer's monthly electric bill. Non-Customer participants will be issued a monthly invoice that reflects their designated fixed dollar per month amount. The Program funds will wholly be used to purchase green energy or cover the green energy price premium. PROGRAM CONSIDERATIONS No electric service disconnections will result in the event of non-payment of Program commitments.

207

Data:E2d97b12-a1ba-4919-b041-0ce6b9bc25dd | Open Energy Information  

Open Energy Info (EERE)

7b12-a1ba-4919-b041-0ce6b9bc25dd 7b12-a1ba-4919-b041-0ce6b9bc25dd No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northern States Power Co - Wisconsin Effective date: 2012/01/15 End date if known: Rate name: Experimental Advanced Renewable Energy Purchase Service Solar Energy Systems 10 kW (at more than 200 amps) Sector: Description: Effective In All territories served by the Company. Definition: Distributed generation facilities are electricity generators owned by the customer, located R close to the point of energy consumption, and small in scale, usually no more than the existing load of the customer. Availability The advanced renewable energy tariff is available to retail customers who own small distributed generation facilities that are powered by a renewable resource and placed in initial service after January 1, 2012, or who executed an advanced renewable energy contract prior to January 1, 2012. aximum size project per customer is: Solar: 10 kW Technology Limit The solar technology category will be fully subscribed when 300 kW of capacity has been subscribed. Community-based Limits The Community-based Project Category is only applicable to the Biomass/Biogas and Wind technology categories and will be fully subscribed when 5 MW of capacity has been subscribed. In addition, the Community-based Category is applicable only to projects owned by local units of government (Village, City, Town or County), or to projects majority-owned by existing retail customers that choose to join together to develop a joint project. The customer will receive a $1.50/watt capital incentive payment up to a total of $15,000 per facility.

208

Thermally stable compositions including 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt  

DOE Patents [OSTI]

An explosive formulation including 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt and a high temperature binder is disclosed together with a process of preparing 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt.

Hiskey, Michael A. (Los Alamos, NM); Huynh, My Hang (Los Alamos, NM)

2010-01-26T23:59:59.000Z

209

Combined effect of chemical pressure and valence electron concentration through the electron-deficient Li substitution on the RE{sub 4}LiGe{sub 4} (RE=La, Ce, Pr, and Sm) system  

SciTech Connect (OSTI)

Four members of the RE{sub 4}LiGe{sub 4} (RE=La, Ce, Pr, and Sm) system have been prepared by high-temperature reaction method and characterized by X-ray diffractions. All compounds crystallize in the orthorhombic Gd{sub 5}Si{sub 4}-type structure (space group Pnma, Pearson code oP16) with bonding interactions for interslab Ge{sub 2} dimers. The Li substitution for rare-earth elements in the RE{sub 4}LiGe{sub 4} system leads to a combined effect of the increased chemical pressure and the decreased valance electron concentration (VEC), which eventually results in the structure transformation from the Sm{sub 5}Ge{sub 4}-type with all broken interslab GeGe bond for the parental RE{sub 5}Ge{sub 4} to the Gd{sub 5}Si{sub 4}-type structure for the ternary RE{sub 4}LiGe{sub 4} (RE=La, Ce, Pr, and Sm) system. Site-preference between rare-earth metals and Li is proven to generate energetically the most favorable atomic arrangements according to coloring-problem, and the rationale is provided using both the size-factor and the electronic-factor related, respectively, to site-volume and electronegativity as well as QVAL values. Tight-binding, linear-muffin-tin-orbital (TB-LMTO) calculations are performed to investigate electronic densities of states (DOS) and crystal orbital Hamilton population (COHP) curves. The influence of reduced VEC for chemical bonding including the formation of interslab Ge{sub 2} dimers is also discussed. The magnetic property measurements prove that the non-magnetic Li substitution leads to the ferromagnetic (FM)-like ground state for Ce{sub 4}LiGe{sub 4} and the co-existence of antiferromagntic (AFM) and FM ground states for Sm{sub 4}LiGe{sub 4}. - Graphical abstract: Reported is a combined effect of the chemical pressure and the reduced VEC caused by the smaller monovalent non-magnetic Li substitution for the larger trivalent magnetic rare-earth metals in the RE{sub 4}LiGe{sub 4} (RE=La, Ce, Pr, and Sm) system. This results in the structure transformation from the Sm{sub 5}Ge{sub 4}-type to the Gd{sub 5}Si{sub 4}-type structure and the changes in magnetic properties. Display Omitted - Highlights: Four Li-containing intermetallic compounds RE{sub 4}LiGe{sub 4} (RE=La, Ce, Pr and Sm) were synthesized. The combined effect of the chemical pressure and the reduced VEC caused by Li substitution for a rare-earth metal results in the structure transformation. Electronic structures and magnetic properties of title compounds were thoroughly investigated.

Nam, Gnu; Jeon, Jieun; Kim, Youngjo [Department of Chemistry, Chungbuk National University, Cheongju, Chungbuk 361-763 (Korea, Republic of); Kwon Kang, Sung [Department of Chemistry, Chungnam National University, Daejeon, Chungnam 305-764 (Korea, Republic of); Ahn, Kyunghan [Advanced Materials Research Center, Samsung Advanced Institute of Technology, Yongin-si, Gyeonggi-do 446-712 (Korea, Republic of); You, Tae-Soo, E-mail: tsyou@chungbuk.ac.kr [Department of Chemistry, Chungbuk National University, Cheongju, Chungbuk 361-763 (Korea, Republic of)

2013-09-15T23:59:59.000Z

210

Colossal anisotropic resistivity and oriented magnetic domains in strained La{sub 0.325}Pr{sub 0.3}Ca{sub 0.375}MnO{sub 3} films  

SciTech Connect (OSTI)

Magnetic and resistive anisotropies have been studied for the La{sub 0.325}Pr{sub 0.3}Ca{sub 0.375}MnO{sub 3} films with different thicknesses grown on low symmetric (011)-oriented (LaAlO{sub 3}){sub 0.3}(SrAl{sub 0.5}Ta{sub 0.5}O{sub 3}){sub 0.7} substrates. In the magnetic and electronic phase separation region, a colossal anisotropic resistivity (AR) of ?10{sup 5}% and an anomalous large anisotropic magnetoresistance can be observed for 30 nm film. However, for 120 nm film, the maximum AR decreases significantly (?2??10{sup 3}%) due to strain relaxation. The colossal AR is strongly associated with the oriented formation of magnetic domains, and the features of the strain effects are believed to be useful for the design of artificial materials and devices.

Jiang, Tao; Yang, Shengwei; Liu, Yukuai; Zhao, Wenbo; Feng, Lei; Li, Xiaoguang, E-mail: lixg@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale, Department of Physics, University of Science and Technology of China, Hefei 230026 (China); Zhou, Haibiao; Lu, Qingyou [Hefei National Laboratory for Physical Sciences at Microscale, Department of Physics, University of Science and Technology of China, Hefei 230026 (China); High Magnetic Field Laboratory, Chinese Academy of Sciences and University of Science and Technology of China, Hefei 230031 (China); Hou, Yubin [High Magnetic Field Laboratory, Chinese Academy of Sciences and University of Science and Technology of China, Hefei 230031 (China)

2014-05-19T23:59:59.000Z

211

Ultrafast near-infrared spectroscopic study of coherent phonons in the phase-separated manganite La1/4Pr3/8Ca3/8MnO3  

Science Journals Connector (OSTI)

We report the generation of coherent optical and acoustic phonons in mixed valent manganite La1/4Pr3/8Ca3/8MnO3 using femtosecond infrared pump-probe spectroscopy. Temperature-dependent measurements of the time-resolved optical reflectance, obtained over a range of 5300 K, revealed that the energy of the photoexcited electrons dissipated during relaxation to acoustic phonons, in the high-temperature paramagnetic phase, and to optical phonons, in the low-temperature charge-ordering phase. Analysis of the temperature-dependent behavior reveals that the modal amplitudes of the coherent phonons appear strongly correlated with the charge-ordering phase.

Kyeong-Jin Jang, Jongseok Lim, Jaewook Ahn, Ji-Hee Kim, Ki-Ju Yee, and Jai Seok Ahn

2010-06-11T23:59:59.000Z

212

Suppression of the metal-insulator transition by magnetic field in (Pr{sub 1?y}Y{sub y}){sub 0.7}Ca{sub 0.3}CoO{sub 3} (y?=?0.0625)  

SciTech Connect (OSTI)

The (Pr{sub 1?y}Y{sub y}){sub 0.7}Ca{sub 0.3}CoO{sub 3} compound (y?=?0.0625, T{sub MI-SS}=40?K), at the lower limit for occurrence of the first-order metal-insulator (MI) and simultaneous spin-state (SS) transitions, has been studied using electrical resistivity and magnetization measurements in magnetic fields up to 17?T. The isothermal experiments demonstrate that the low-temperature insulating phase can be destabilized by an applied field and the metallic phase returns well below the transition temperature T{sub MI-SS}. The reverse process with decreasing field occurs with a significant hysteresis. The temperature scans taken at fixed magnetic fields reveal a parabolic-like decrease in T{sub MI-SS} with increasing field strength and a complete suppression of the MI-SS transition in fields above 9?T.

Naito, Tomoyuki, E-mail: tnaito@iwate-u.ac.jp; Fujishiro, Hiroyuki [Faculty of Engineering, Iwate University, Morioka 020-8551 (Japan); Nishizaki, Terukazu; Kobayashi, Norio [Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Hejtmnek, Ji?; Knek, Karel; Jirk, Zden?k [Institute of Physics, ASCR, Cukrovarnick 10, 162 00 Prague 6 (Czech Republic)

2014-06-21T23:59:59.000Z

213

Crystallinity dependence of resistive switching in Ti/Pr(Sr{sub 0.1}Ca{sub 0.9}){sub 2}Mn{sub 2}O{sub 7}/Pt: Filamentary versus interfacial mechanisms  

SciTech Connect (OSTI)

The resistive switching characteristics of two Pr(Sr{sub 0.1}Ca{sub 0.9}){sub 2}Mn{sub 2}O{sub 7} (PSCMO)-based devices (Ti/PSCMO-1/Pt and Ti/PSCMO-2/Pt) prepared under different conditions have been investigated. The two devices both showed bipolar switching behaviors. Scanning electron microscope measurements showed different grain boundaries in the two PSCMO films. By fitting the I-V curves and area dependence of the device resistance, we found that the Ti/PSCMO-1/Pt device indicated filamentary conduction, whereas interfacial effects dominated the conductance in Ti/PSCMO-2/Pt device. Our results suggest that the different grain boundaries may play a critical role in oxygen vacancy movement and hence result in the two different resistive switching properties.

Song, L. W.; Niu, S. S.; Sun, Y. C.; Hua, L. F.; Zhao, X., E-mail: xzhao@hebtu.edu.cn; Chen, W. [College of Physics Science and Information Engineering, Hebei Normal University, Shijiazhuang 050024 (China); Key Laboratory of Advanced Films of Hebei Province, Shijiazhuang 050024 (China)

2014-03-03T23:59:59.000Z

214

Vortex-lattice activation energy deduced from irreversibility lines for (PrBa2Cu3-xGaxO7)M/(YBa2Cu3O7)N superlattices  

Science Journals Connector (OSTI)

The activation energy of the vortex structure in high anisotropic (PrBa2Cu3-xGaxO7)M/(YBa2Cu3O7)N superlattices with a layer thickness of the superconductor in the range 1.24.8 nm and with no Josephson coupling between the YBa2Cu3O7 elementary layers has been deduced from irreversibility lines Tirr(H). The activation energy is proportional to the thickness of the elementary YBa2Cu3O7 layer and to the logarithm of the field H, whereas it follows a TAFF behavior for a YBa2Cu3O7 single film. The origin of the activation energy is discussed in light of recent theories on vortex dynamic. The anisotropies deduced from both Tirr(H) and the Kosterlitz-Thouless analysis of the resistive transition are found to be strongly correlated.

D. Ravelosona, J. P. Contour, and N. Bontemps

2000-03-01T23:59:59.000Z

215

Electronic Inhomogeneity and Completing Phases in Electron-Doped Superconducting Pr0.88LaCe0.12CuO4-?  

SciTech Connect (OSTI)

We use neutron scattering to demonstrate that electron-doped superconducting Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} in the underdoped regime is electronically phase separated in the ground state, showing the coexistence of a superconducting phase with a three-dimensional antiferromagnetically ordered phase and a quasi-two-dimensional spin-density wave modulation. The Neel temperature of both antiferromagnetic phases decreases linearly with increasing superconducting transition temperature (T{sub c}) and vanishes when optimal superconductivity is achieved. These results indicate that the electron-doped copper oxides are close to a quantum critical point, where the delicate energetic balance between different competing states leads to microscopic heterogeneity.

Dai, Pengcheng [ORNL; Kang, H. J. [University of Tennessee, Knoxville (UTK); Mook Jr, Herbert A [ORNL; Matsuura, Masato [ORNL; Lynn, J. W. [National Institute of Standards and Technology (NIST); Kurita, Y. [Central Research Institute of Electric Power Industry, Japan; Komiya, S. [Central Research Institute of Electric Power Industry, Japan; Ando, Y. [Central Research Institute of Electric Power Industry, Japan

2005-01-01T23:59:59.000Z

216

Nature of the quantum spin correlations through the superconducting?normal phase transition in electron-doped superconducting Pr0.88LaCe0.12CuO4  

SciTech Connect (OSTI)

We use neutron scattering and specific heat measurements to relate the response of the spin fluctuations and static antiferromagnetic (AF) order to the superconductivity in the electron-doped high-transition-temperature superconductor, Pr{sub .88}LaCe{sub .12}CuO{sub 4-{delta}} (PLCCO) (T{sub c} = 24 K), as the system is tuned via a magnetic field applied beyond the upper critical field (H{sub c2}) and driven into the normal state. The strength of the collective magnetic excitation commonly termed 'resonance' decreases smoothly with increasing field and vanishes in the normal state, paralleling the behavior of the superconducting condensation energy. The suppression of superconductivity is accompanied by a smooth reduction in the very low energy spin fluctuations, and the concomitant emergence of static AF order. Our results suggest an intimate connection between the resonance and the superconducting condensation energy.

Dai, Pengcheng [ORNL; Wilson, Stephen D. [University of Tennessee, Knoxville (UTK); Li, Shiliang [University of Tennessee, Knoxville (UTK); Wen, H. H. [Chinese Academy of Sciences

2008-01-01T23:59:59.000Z

217

Electronic inhomogeneity and competing phases in electron-doped superconducting Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}}  

SciTech Connect (OSTI)

We use neutron scattering to demonstrate that electron-doped superconducting Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} in the underdoped regime is electronically phase separated in the ground state, showing the coexistence of a superconducting phase with a three-dimensional antiferromagnetically ordered phase and a quasi-two-dimensional spin-density wave modulation. The Neel temperature of both antiferromagnetic phases decreases linearly with increasing superconducting transition temperature (T{sub c}) and vanishes when optimal superconductivity is achieved. These results indicate that the electron-doped copper oxides are close to a quantum critical point, where the delicate energetic balance between different competing states leads to microscopic heterogeneity.

Dai Pengcheng [Department of Physics and Astronomy, The University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Condensed Matter Sciences Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Kang, H.J. [Department of Physics and Astronomy, The University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Mook, H.A.; Matsuura, M. [Condensed Matter Sciences Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Lynn, J.W. [NIST Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8562 (United States); Kurita, Y.; Komiya, Seiki; Ando, Yoichi [Central Research Institute of Electric Power Industry, Komae, Tokyo 201-8511 (Japan)

2005-03-01T23:59:59.000Z

218

Parity meter for charge qubits: An efficient quantum entangler B. Trauzettel,1,2 A. N. Jordan,3,4 C. W. J. Beenakker,1 and M. Bttiker3  

E-Print Network [OSTI]

Parity meter for charge qubits: An efficient quantum entangler B. Trauzettel,1,2 A. N. Jordan,3,4 C parity meter based on two double quantum dots alongside a quantum point contact. Such a device off the parity meter. Two applications of the parity meter are discussed: the measurement of Bell

219

Substrate-dependent post-annealing effects on the strain state and electrical transport of epitaxial La{sub 5/8-y}Pr{sub y}Ca{sub 3/8}MnO{sub 3} films  

SciTech Connect (OSTI)

Large scale electronic phase separation (EPS) between ferromagnetic metallic and charge-ordered insulating phases in La{sub 5/8-y}Pr{sub y}Ca{sub 3/8}MnO{sub 3} (y = 0.3) (LPCMO) is very sensitive to the structural changes. This work investigates the effects of post-annealing on the strain states and electrical transport properties of LPCMO films epitaxially grown on (001){sub pc} SrTiO{sub 3} (tensile strain), LaAlO{sub 3} (compressive strain) and NdGaO{sub 3} (near-zero strain) substrates. Before annealing, all the films are coherent-epitaxial and insulating through the measured temperature range. Obvious change of film lattice is observed during the post-annealing: the in-plane strain in LPCMO/LAO varies from ?1.5% to ?0.1% while that in LPCMO/STO changes from 1.6% to 1.3%, and the lattice of LPCMO/NGO keeps constant because of the good lattice-match between LPCMO and NGO. Consequently, the varied film strain leads to the emergence of metal-insulator transitions (MIT) and shift of the critical transition temperature in the electrical transport. These results demonstrate that lattice-mismatch combined with post-annealing is an effective approach to tune strain in epitaxial LPCMO films, and thus to control the EPS and MIT in the films.

Hu, Sixia; Wang, Haibo; Dong, Yongqi; Hong, Bing; He, Hao; Bao, Jun [National Synchrotron Radiation Laboratory and School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230026 (China); Huang, Haoliang [CAS Key Laboratory of Materials for Energy Conversion and Collaborative Innovation Center of Chemistry for Energy Materials, University of Science and Technology of China, Hefei, Anhui 230026 (China); Yang, Yuanjun; Luo, Zhenlin, E-mail: zlluo@ustc.edu.cn; Yang, Mengmeng; Gao, Chen, E-mail: cgao@ustc.edu.cn [National Synchrotron Radiation Laboratory and School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230026 (China); CAS Key Laboratory of Materials for Energy Conversion and Collaborative Innovation Center of Chemistry for Energy Materials, University of Science and Technology of China, Hefei, Anhui 230026 (China)

2014-06-15T23:59:59.000Z

220

Temperature dependent electronic structure of Pr{sub 0.67}Sr{sub 0.33}MnO{sub 3} film probed by X-ray absorption near edge structure  

SciTech Connect (OSTI)

The Mn K edge X-ray absorption near edge structures (XANES) of Pr{sub 0.67}Sr{sub 0.33}MnO{sub 3} film (100 nm) on (001) LaAlO{sub 3} substrate was measured at different temperatures to probe the MnO{sub 6} octahedron distortion and corresponding electronic structure. The absorption of high temperature paramagnetic-insulator phase differed from that of the low temperature ferromagnetic-metal phase. The temperature-dependent absorption intensity of Mn K edge XANES was correlated with the relaxation of distorted MnO{sub 6} octahedron, which changed the crystal field acting on the Mn site and the related electronic structure and properties. At low temperature, the splitting of Mn majority e{sub g} orbitals decreased and the density of states above the Fermi level increased in the relaxed MnO{sub 6} octahedron, as reflected by a wider separation between two sub-peaks in the pre-edge XANES spectra.

Zhang, Bangmin [Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Department of Materials Science and Engineering, National University of Singapore, Singapore 117576 (Singapore); NUSNNI-Nanocore, National University of Singapore, Singapore 117411 (Singapore); Sun, Cheng-Jun, E-mail: cjsun@aps.anl.gov, E-mail: msecgm@nus.edu.sg; Heald, Steve M. [Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Chen, Jing-Sheng; Moog Chow, Gan, E-mail: cjsun@aps.anl.gov, E-mail: msecgm@nus.edu.sg [Department of Materials Science and Engineering, National University of Singapore, Singapore 117576 (Singapore); Venkatesan, T. [NUSNNI-Nanocore, National University of Singapore, Singapore 117411 (Singapore); Department of Physics, National University of Singapore, Singapore 117542 (Singapore); Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore)

2014-05-07T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Magnetic manipulation by resistance switching in CeO{sub 2}/PrBa{sub 2}Cu{sub 3}O{sub 7??}/Pt heterostructure: The role of oxygen vacancies  

SciTech Connect (OSTI)

Pronounced bipolar resistance switching with a good retention property has been observed in CeO{sub 2}/PrBa{sub 2}Cu{sub 3}O{sub 7??}/Pt heterostructure. The low resistance state and high resistance state exhibited distinguished ferromagnetic signals, as compared to the nearly non-magnetic initial state. It is found that the migration of the oxygen vacancies under electric field is mainly responsible for the electric and the magnetic changes. The modified interfacial electronic structure by the oxygen vacancy migration and the trapping/detrapping of the carriers leads to the resistance switching. The exchange interaction of the hydrogen-like orbitals formed around the singly occupied oxygen vacancies in CeO{sub 2} is accounting for the emerged and modulated ferromagnetic signals. Temperature dependence of resistance in the low resistance state follows a variable range hopping law, further confirming that the amount of oxygen vacancies in the CeO{sub 2} layer directly affects the hydrogen-like orbital radius, which determines the strength of the ferromagnetic coupling.

Yun, C.; Chen, X. G.; Fu, J. B.; Sun, J. R.; Zhang, Y. X.; Wang, Y. F.; Zhang, Y.; Liu, S. Q.; Xiong, G. C.; Lian, G. J.; Yang, Y. C. [State Key Laboratory for Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China)] [State Key Laboratory for Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China); Yang, J. B. [State Key Laboratory for Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China) [State Key Laboratory for Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, Beijing (China)

2013-12-23T23:59:59.000Z

222

High-Energy Spin Excitations in the Electron-Doped Superconductor Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} with T{sub c}=21 K  

SciTech Connect (OSTI)

We use high-resolution inelastic neutron scattering to study the low-temperature magnetic excitations of the electron-doping superconductor Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} (T{sub c}=21{+-}1 K) over a wide energy range (4 meV{<=}({Dirac_h}/2{pi}){omega}{<=}330 meV). The effect of electron doping is to cause a wave vector (Q) broadening in the low-energy (({Dirac_h}/2{pi}){omega}{<=}80 meV) commensurate spin fluctuations at (0.5, 0.5) and to suppress the intensity of spin-wave-like excitations at high energies (({Dirac_h}/2{pi}){omega}{>=}100 meV). This leads to a substantial redistribution in the spectrum of the local dynamical spin susceptibility {chi}{sup ''}({omega}), and reveals a new energy scale similar to that of the lightly hole-doped YB{sub 2}Cu{sub 3}O{sub 6.353} (T{sub c}=18 K)

Wilson, Stephen D.; Li Shiliang; Woo, Hyungje [Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Dai, Pengcheng [Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Center for Neutron Scattering, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Mook, H.A. [Center for Neutron Scattering, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Frost, C.D. [ISIS Facility, Rutherford Appleton Laboratory, Oxon OX11 0QX (United Kingdom); Komiya, Seiki; Ando, Yoichi [Central Research Institute of Electric Power Industry, Komae, Tokyo 201-8511 (Japan)

2006-04-21T23:59:59.000Z

223

Evolution of low-energy spin dynamics in the electron-doped high-transition-temperature superconductor Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}}  

SciTech Connect (OSTI)

We use inelastic neutron scattering to explore the evolution of the low energy spin dynamics in the electron-doped cuprate Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} (PLCCO) as the system is tuned from its nonsuperconducting, as-grown antiferromagnetic (AF) state into an optimally doped superconductor (T{sub c}{approx_equal}24 K) without static AF order. The low-temperature, low-energy response of the spin excitations in underdoped samples is coupled to the presence of the AF phase, whereas the low-energy magnetic response for samples near optimal T{sub c} exhibits spin fluctuations surprisingly insensitive to the sample temperature. This evolution of the low-energy excitations is consistent with the influence of a quantum critical point in the phase diagram of PLCCO associated with the suppression of the static AF order. We carried out scaling analysis of the data and discuss the influence of quantum critical dynamics in the observed excitation spectrum.

Wilson, Stephen D.; Li Shiliang [Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Dai Pengcheng [Department of Physics and Astronomy, University of Tennessee, Knoxville, Tennessee 37996-1200 (United States); Center for Neutron Scattering, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6393 (United States); Bao, Wei [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Chung, Jae-Ho; Kang, H. J. [NIST Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, Maryland 20899-8562 (United States); Department of Materials Science and Engineering, University of Maryland, College Park, Maryland 20742-2115 (United States); Lee, Seung-Hun [Department of Physics, University of Virginia, Charlottesville, Virginia 22904-4714 (United States); Komiya, Seiki; Ando, Yoichi [Central Research Institute of Electric Power Industry, Komae, Tokyo 201-8511 (Japan); Si, Qimiao [Department of Physics and Astronomy, Rice University, Houston, Texas 77005 (United States)

2006-10-01T23:59:59.000Z

224

Problems #3, Math 204, Dr. M. Bohner. Sep 10, 2003. Due Sep 15, 11 am. 12. A tank has ten gallons of water in which two pounds of salt has been dissolved. Brine with  

E-Print Network [OSTI]

Problems #3, Math 204, Dr. M. Bohner. Sep 10, 2003. Due Sep 15, 11 am. 12. A tank has ten gallons through the supplementary homework problems for Chapters 1­2: 1, 3 of Section 1.1; 1 of Section 1.2; 1-8, 14, 15, 17, 19, 21, 25, 26 of Section 1.3; 1, 3, 4, 13­17, 21, 26, 29 of Section 2.1; 1, 4­8, 9, 11

Bohner, Martin

225

Synthesis, structural characterization and Mssbauer study of LnV{sub 0.5}Fe{sub 0.5}O{sub 3} perovskites (Ln = Y, La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho and Er)  

SciTech Connect (OSTI)

Graphical abstract: Mssbauer spectra taken at 200 K for the Y(V{sub 0.5}Fe{sub 0.5})O{sub 3} orthoferrivanadate synthesized by arc-melting. Highlights: ? LnFe{sub 0.5}V{sub 0.5}O{sub 3} were synthesized by the first time for most of the rare-earth elements. ? These orthoferrivanadates crystallize metastably with the perovskite structure. ? Iron and vanadium are trivalent stabilized in these solid solutions. ? The Mssbauer quadrupolar splitting is correlated with the tolerance factor. ? Below 100 K, these perovskites undergo a crystallographic phase transformation. -- Abstract: Perovskites LnV{sub 0.5}Fe{sub 0.5}O{sub 3} (Ln = Y, La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho and Er) were synthesized by rapid solidification from arc-melted samples and characterized by the study of their crystal structure and hyperfine properties. These metastable solid solutions crystallized in the Pbnm symmetry, with the iron and vanadium cations randomly distributed in the transition metal octahedral sites. Depending on the lanthanide present at the A site of the perovskite, iron is present with two valences (i.e., Fe{sup 3+} and Fe{sup 2+}). The volume of the unit cell for these perovskites increases linearly with the lanthanide ionic radius, as the perovskite approaches its ideal structure. At room temperature, the quadrupolar splitting of the trivalent paramagnetic Mssbauer component works as an indirect measurement for the Goldshmidt tolerance factor. Close to or below 100 K, these perovskites undergo a crystallographic phase transformation, probably due to orbital ordering of the V{sup 3+} cations, originating two different magnetic iron sites.

Ivashita, Flvio F.; Biondo, Valdecir; Bellini, Jusmar V.; Paesano, Andrea [Departamento de Fsica, Universidade Estadual de Maring, Av. Colombo 5790, 87.020-900 Maring, PR (Brazil)] [Departamento de Fsica, Universidade Estadual de Maring, Av. Colombo 5790, 87.020-900 Maring, PR (Brazil); Blanco, M. Cecilia; Fuertes, Valeria C.; Pannunzio-Miner, Elisa V. [INFIQC-CONICET, Departamento de Fisicoqumica, Facultad de Ciencias Qumicas, Universidad Nacional de Crdoba, X5000HUA Crdoba (Argentina)] [INFIQC-CONICET, Departamento de Fisicoqumica, Facultad de Ciencias Qumicas, Universidad Nacional de Crdoba, X5000HUA Crdoba (Argentina); Carbonio, Ral E., E-mail: carbonio@fcq.unc.edu.ar [INFIQC-CONICET, Departamento de Fisicoqumica, Facultad de Ciencias Qumicas, Universidad Nacional de Crdoba, X5000HUA Crdoba (Argentina)

2012-09-15T23:59:59.000Z

226

Resonance in the Electron-doped High-Tc Superconductor Pr0.88LaCe0.12CuO4-?  

SciTech Connect (OSTI)

In conventional superconductors, the interaction that pairs the electrons to form the superconducting state is mediated by lattice vibrations (phonons). In high-transition-temperature (high-T{sub c}) copper oxides, it is generally believed that magnetic excitations might play a fundamental role in the superconducting mechanism because superconductivity occurs when mobile 'electrons' or 'holes' are doped into the antiferromagnetic parent compounds. Indeed, a sharp magnetic excitation termed 'resonance' has been observed by neutron scattering in a number of hole-doped materials. The resonance is intimately related to superconductivity, and its interaction with charged quasi-particles observed by photoemission, optical conductivity, and tunnelling suggests that it might play a part similar to that of phonons in conventional superconductors. The relevance of the resonance to high-T{sub c} superconductivity, however, has been in doubt because so far it has been found only in hole-doped materials. Here we report the discovery of the resonance in electron-doped superconducting Pr{sub 0.88}LaCe{sub 0.12}CuO{sub 4-{delta}} (T{sub c} = 24 K). We find that the resonance energy (E{sub r}) is proportional to T{sub c} via E{sub r} {approx} 5.8k{sub B}T{sub c} for all high-T{sub c} superconductors irrespective of electron- or hole-doping. Our results demonstrate that the resonance is a fundamental property of the superconducting copper oxides and therefore must be essential in the mechanism of superconductivity.

Wilson, Stephen D. [University of Tennessee, Knoxville (UTK); Dai, Pengcheng [University of Tennessee, Knoxville (UTK); Li, Shiliang [University of Tennessee, Knoxville (UTK); Chi, Songxue [University of Tennessee, Knoxville (UTK); Kang, H. J. [University of Tennessee, Knoxville (UTK); Lynn, J. W. [National Institute of Standards and Technology (NIST)

2006-01-01T23:59:59.000Z

227

Présentation PowerPoint  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sulfur Sulfur Electrolyzer Workshop - 20-21 April 2009 - 1 DEN/DANS/DPC/SCCME Characterization and optimization of materials for hybrid sulfur cycle electrolyser CEA Saclay R. Robin, N. Gruet Laboratory of Non Aqueous Corrosion DEN/DPC/SCCME Hybrid Sulfur Electrolyzer Workshop - 20-21 April 2009 - 2 DEN/DANS/DPC/SCCME Hybrid Sulfur Cycle Electrolyser - Schematic Diagram Electrochemical Step Electrochemical Step Oxidation of SO 2 and Reduction of proton SO 2 + 2 H H 2 2 O O → H H 2 2 + H 2 SO 4 Recycling Intermediate H 2 SO 4 SO 2 H 2 O O 2 SO 3 HTR H 2 H 2 O 900°C 100°C 600°C Thermochemical Thermochemical Step Step Thermal decomposition of H 2 SO 4 H 2 2 SO 4 4 → SO 3 3 + H 2 2 O SO 2 2 + ½ O O 2 2 Hybrid Sulfur Electrolyzer Workshop - 20-21 April 2009 - 3 DEN/DANS/DPC/SCCME Hybrid Sulfur Cycle Electrolyzer - Objective Main objective of the study

228

Microsoft Word - PR-10085844 NEPA.docx  

Broader source: Energy.gov (indexed) [DOE]

5844 5844 Title: Replace BC 500 KVA Power Transformer Description: Subcontractor shall provide all labor, supervision, tools, equipment, and transportation required to procure, transport, install, test and pre-commission the new BC 500 KVA power transformer, SDTFW and new switch assembly. Work includes transportation of the transformer and switch assembly from the manufacturer's plant to BC; removal of existing equipment; unloading, assembly and installation of new equipment; and pre-commission testing. Subcontractor shall provide the lifting equipment required to remove the existing transformer and switch assembly, and to install the new equipment. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions)

229

Présentation PowerPoint  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cirrus cloud Cirrus cloud radiative radiative forcing forcing Cirrus cloud Cirrus cloud radiative radiative forcing forcing on surface on surface - - level shortwave and level shortwave and longwave longwave irradiances irradiances at regional and global scale at regional and global scale M. Haeffelin 1 , J-C. Dupont 1 , C. Long 2 1 Institut Pierre et Simon Laplace, Ecole Polytechnique/CNRS, France 2 Pacific Northwest National Laboratory, Richland WA, USA The authors acknowledge the US ARM program, the IPSL observatories and the NASA/CNES CALIPSO and NASA/AIRS programs for providing the data used in this study. We thank the Centre National d'Etudes Spatiales (CNES) and Centre National de la Recherche Scientifique (CNRS) for their support in this study. 19th ARM Science Team Meeting 1 Apr 2009 0 25 50 75 (%) Stubenrauch et al. (2006)

230

PowerPoint-Präsentation  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Instrument Retrievals: Applications and New Synergies Instrument Retrievals: Applications and New Synergies Can we derive LWC profiles from MWRs ? U. Löhnert 1 , S. Crewell 1 , K. Ebell 1 , D. Turner 2 1 University of Cologne, Germany 2 University of Wisconsin-Madison, Madison, Wisconsin RHUBC-I, Alaska, 2007 ARM Science Team Meeting, 30 March -2 April 2009, Louisville, KY Summary "New" Synergies - Microwave & Infrared Method for combining measurements Acknowledgements: We thank the ARM Program and the German Science Foundation (DFG) for their support. * IPT (1DVar retrieval approach) applied to AMF-COPS dataset to retrieve temperature, humidity and LWC profiles from a combined a suite of sensors. * IPT results and errors are used to estimate SW/LW fluxes and their corresponding errors. * AERI retrievals of clear-sky temperature and humidity profiles outperform

231

PowerPoint-Präsentation  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mass Spectrometry (AMS) Mass Spectrometry (AMS) at ATLAS Walter Kutschera Vienna Environmental Research Accelerator (VERA) Fakultät für Physik, Universität Wien, Austria ATLAS 25 th Anniversary Celebration Physics Division, Argonne National Laboratory 22-23 October 2010 AMS at ATLAS over the years Year Radioisotope Accelerator Topic 1979 14 C, 26 Al, 32 Si, 36 Cl Tandem Detection with split-pole spectrograph 1980 32 Si Tandem Half-life measurement (101 yr) 1980 26 Al Tandem Cross section 26 Mg(p,γ) 26 Al 1983 44 Ti Tandem Half-life measurement (54 yr) 1984 B - - , C - - , O - - Tandem No evidence found ( <10 -15 ) 1984 60 Fe Tandem+Linac Half-life measurement (1.5x10 6 yr) 1984 Free quarks Injector Fermi Lab Cryogenic search for free quarks 1987 41 Ca Tandem+Linac+GFM Developing a 41 Ca dating method 1993 59 Ni Tandem+Linac+FS Solar CR alphas

232

EM-PR-0001-001.PDF  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Chemical use forms are posted at each beamline 13. If someone has collapsed in the cleanroom from suspected chemical exposure, do not enter the cleanroom. To do so may endanger...

233

GS-PR-0002-001.PDF  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

being able to move the dewar for filling. Note: For the large dewar supplying the cleanroom, disconnect the line running into the cleanroom, using the wrench supplied for this...

234

M. Alain Pr M. Didier A  

E-Print Network [OSTI]

Profe d'Ess Profe d'Ess ersité d octorale Habilitat lyse de l identific télévigi D esseur des U esseur, Univer Universités ulaire, Univ cherche CN cherche, IF enoble INP Universités Universités Val d'Ess ces Antip Profe Profe Direc XI Direc Profe Profe d'Ess Profe d'Ess ersité d octorale Habilitat lyse de l

Paris-Sud XI, Université de

235

Pageflex Server [document: PR5018074_00001  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

or call 800.877.7195. * Review your benefit information. Visit vsp.com to review your plan coverage before your appointment. * At your appointment, tell them you have VSP....

236

GS-PR-0003-001.PDF  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

lead cooling valves on wiggler. 9. Adjust potentiometer on wiggler liquid level meter to "maximum read". 10. The liquid level in the dewar can be established with the...

237

Pr esent ee par Fabienne NAEGELE  

E-Print Network [OSTI]

::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 7 Chapitre 1 Th eor#12;emes d'indices pour les equations q-diff erences-diff erentielles :::::::13 en eralis es :::::::::::::::::::::::::::::::::::::::::::::::::::::: 15 4. Th eor#12;emes d'indices et ;r;;-op erateurs :::::::::::::::::::::::::::::::::::::::::::::::::::::::: 20 4.4. Th eor#12;emes d

Boyer, Edmond

238

NewsletterPR WRRI Highlights Inside  

E-Print Network [OSTI]

. The Y2K Dilema 3. Use of Municipal Wastewater in California 4. EPA is Required to Develop a National in the 20th Century El Niño-Goes to the University Computers, Water and the Y2K Municipal Wastewater must be your num- ber one priority. 2. Financial Control: The US Secu- rities Exchange Commission

Gilbes, Fernando

239

CONTROL OF HAZARDOUS ENERGY 12.A GENERAL  

E-Print Network [OSTI]

on or near any system that produces, uses, or stores hazardous energy, a hazardous energy control program by the contractor-managed HECP (e.g., QA's on construction sites, etc.), they shall comply with the contractor and implementation of these activities. Each shall inform the other of their HECPs and Hazardous Energy Control (HEC

US Army Corps of Engineers

240

CONTROL OF HAZARDOUS ENERGY 12.A GENERAL  

E-Print Network [OSTI]

as all requirements of 1910.147, ANSI Z244.1, and ANSI A10.44. c. When contractor work involving.147, ANSI Z244.1, and ANSI A10.44. When a site is controlled by a contractor and USACE employees

US Army Corps of Engineers

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Data:Ea6a12a3-4a11-4d01-8ca1-0be1b3e38aeb | Open Energy Information  

Open Energy Info (EERE)

a12a3-4a11-4d01-8ca1-0be1b3e38aeb a12a3-4a11-4d01-8ca1-0be1b3e38aeb No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northern Plains Electric Coop Effective date: 2012/02/01 End date if known: Rate name: SMALL RENEWABLE ENERGY PURCHASE RATE Sector: Description: Availability This rate is applicable for a member-owned renewable energy generating facility with a capacity less than 150 KW which is properly interconnected to the Northern Plains Electric Cooperative electrical system (Qualifying Facility) and which the generated power is sold to Northern Plains. Type of Service Single or three phase, 60 hertz, at available primary or secondary voltages.

242

Data:04c64d7f-c7c7-43f6-aca1-2a7ab06dd02d | Open Energy Information  

Open Energy Info (EERE)

4d7f-c7c7-43f6-aca1-2a7ab06dd02d 4d7f-c7c7-43f6-aca1-2a7ab06dd02d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Delta Montrose Electric Assn Effective date: 2012/01/01 End date if known: Rate name: LARGE COMMERCIAL NET METERING Sector: Commercial Description: Source or reference: http://www.dmea.com/index.php?option=com_content&view=article&id=95&Itemid=72 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:

243

Experimental investigations and three-dimensional transmission line matrix simulation of Ca 5 ? x A x B 2 Ti O 12 ( A = Mg , Zn, Ni, and Co; B = Nb and Ta) ceramic resonators  

Science Journals Connector (OSTI)

Temperature-stable low-loss Ca 5 ? x A x B 2 Ti O 12 ( A = Mg Zn Ni and Co; B = Nb and Ta)dielectrics suitable for microwave telecommunication applications were prepared by the conventional solid-state ceramic route. Investigations were made on the structure and microstructure of the ceramics employing x-ray and scanning electron microscopic techniques. The dielectric properties were measured in the 3.5 7 GHz frequency range. The time domain simulation of electromagnetic wave interaction with dielectric materials using three-dimensional transmission line matrix modeling methods is presented. Excellent agreement between experimental and simulated values of microwavedielectric properties was observed. The materials are potential candidates for applications in filters oscillators and high efficiency low-loss dielectric antennas working especially at millimeter wave region.

Pazhoor Varghese Bijumon; Mailadil Thomas Sebastian; Pezholil Mohanan

2005-01-01T23:59:59.000Z

244

Data:F157faf1-12a5-4c9e-84de-b1ea0d72e277 | Open Energy Information  

Open Energy Info (EERE)

F157faf1-12a5-4c9e-84de-b1ea0d72e277 F157faf1-12a5-4c9e-84de-b1ea0d72e277 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: South Central Indiana REMC Effective date: 2010/06/01 End date if known: Rate name: Residential & Farm Rate - RS - HP Sector: Residential Description: Availability Available as an optional rate to any residential or farm consumer of the Corporation for singlephase electric service at a single delivery point who has an air source heat pump with natural gas or LP gas backup. The air source heat pump system must not have any auxiliary emergency resistance heat installed. A representative of the Corporation must certify the air source heat pump as meeting the requirements of this rate schedule. A Demand Response Unit (DRU) must be installed that allows for control of the air conditioning load during peak periods as determined by the Corporation. The rated capacity of any motor served under this schedule in excess of ten (10) horsepower shall be subject to the approval of the Corporation. A consumer choosing this optional rate must remain on the rate for a minimum of six months. Consumers opting to change to a different rate schedule after the six month minimum period must wait a minimum of six months before returning to this optional rate.

245

Suppression of photovoltaic effect by magnetic field in Pr{sub 0.65}(Ca{sub 0.75}Sr{sub 0.25}){sub 0.35}MnO{sub 3}/Nb:SrTiO{sub 3} heterostructure  

SciTech Connect (OSTI)

The heterostructure composed of Pr{sub 0.65}(Ca{sub 0.75}Sr{sub 0.25}){sub 0.35}MnO{sub 3} and 0.7?wt.% Nb-doped SrTiO{sub 3} was fabricated. The heterostructure exhibits an asymmetric current-voltage relation similar to that of p-n junctions and an obvious photovoltaic effect with its maximum value of about 25.1?mV at T?=?140?K. It is interesting that the magnetic field has a strong suppression effect on photovoltaic effect, and the maximum relative change of photovoltage under the magnetic field of 1?T is about 63% with the illumination of 15 mW/mm{sup 2} light (532?nm) at T???140?K. The physical mechanism is explained by the electronic phase separation mechanism.

Luo, C.; Jin, K. X., E-mail: jinkx@nwpu.edu.cn; Chen, C. L. [Shaanxi Key Laboratory of Condensed Matter Structures and Properties and Key Laboratory of Space Applied Physics and Chemistry, Ministry of Education, School of Science, Northwestern Polytechnical University, Xi'an 710072 (China)] [Shaanxi Key Laboratory of Condensed Matter Structures and Properties and Key Laboratory of Space Applied Physics and Chemistry, Ministry of Education, School of Science, Northwestern Polytechnical University, Xi'an 710072 (China); Wu, T. [Division of Physics and Applied Physics, School of Physical and Mathematical Sciences, Nanyang Technological University, 21 Nanyang Link, Singapore 637371 (Singapore)] [Division of Physics and Applied Physics, School of Physical and Mathematical Sciences, Nanyang Technological University, 21 Nanyang Link, Singapore 637371 (Singapore)

2013-11-18T23:59:59.000Z

246

Coupling of magnetic field and lattice strain and its impact on electronic phase separation in La{sub 0.335}Pr{sub 0.335}Ca{sub 0.33}MnO{sub 3}/ferroelectric crystal heterostructures  

SciTech Connect (OSTI)

Phase-separated La{sub 0.335}Pr{sub 0.335}Ca{sub 0.33}MnO{sub 3} films were epitaxially grown on (001)- and (111)-oriented ferroelectric single-crystal substrates. Upon poling along the [001] or [111] direction, dramatic decrease in resistance, up to 99.98%, and complete melting of the charge-ordered phase were observed, caused by poling-induced strain rather than accumulation of electrostatic charge at interface. Such poling-induced strain effects can be effectively tuned by a magnetic field and mediated by electronic phase separation. In particular, our findings show that the evolution of the strength of electronic phase separation against temperature and magnetic field can be determined by measuring the strain-tunability of resistance [(?R/R){sub strain}] under magnetic fields.

Zheng, M.; Yang, M. M.; Zhu, Q. X.; Li, X. M.; Shi, X.; Luo, H. S.; Zheng, R. K., E-mail: zrk@ustc.edu [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); Li, X. Y. [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China) [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China); Department of Materials Science and Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China); Wang, Y.; Chan, H. L. W. [Department of Applied Physics and Materials Research Center, The Hong Kong Polytechnic University, Hong Kong (China)] [Department of Applied Physics and Materials Research Center, The Hong Kong Polytechnic University, Hong Kong (China); Li, X. G. [Hefei National Laboratory for Physical Sciences at Microscale and Department of Physics, University of Science and Technology of China, Hefei 230026 (China)] [Hefei National Laboratory for Physical Sciences at Microscale and Department of Physics, University of Science and Technology of China, Hefei 230026 (China)

2013-12-23T23:59:59.000Z

247

Microsoft Word - PR_SWG Trial Results_FINAL.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

FOR IMMEDIATE RELEASE MEDIA CONTACT FOR IMMEDIATE RELEASE MEDIA CONTACT Gary Koppenjan 805-376-6546 mediaoffice@ceres.net Ceres Yield Results: Energy Crop Benefits are Greatly Underestimated THOUSAND OAKS, Calif. - May 20, 2009 - Energy crop company Ceres, Inc. announced today that switchgrass can produce substantially more biomass than previously reported and that average yields often used by academics and policymakers to forecast bioenergy economics and environmental benefits may, in fact, be far too conservative. The company reported that yield results from its nation-wide network of field trials showed that average biomass yields among switchgrass seed varieties tested last season were as much as 50% more than the government's projected yields for 2022. Proprietary varieties sold under the

248

RECORD OF CATEGORICAL EXCLUSION DETERMINATION Project ID No. PR 10069318  

Broader source: Energy.gov (indexed) [DOE]

318 318 Title: WH Air Conditioning/Heating Repairs, 2010-2013 Description: Subcontractor shall provide all labor, materials, tools, equipment, transportation and supervision required to tear down, inspect, and perform minor repairs to the air conditioning and heating units at WH on a "will call or as needed basis" during the period from 2010 to 2013. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions).

249

cv15866_JGI_PR_CR:JGI Progress Report  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

E E J G I - p o w e r i n g a s u s t a i n a b l e f u t u r e w i t h t h e s c i e n c e w e n e e d f o r b i o f u e l s , e n v i r o n m e n t a l c l e a n u p , a n d c a r b o n c a p t u r e . 2 0 0 8 P r o g r e s s R e p o r t J o i n t G e n o m e I n s t i t u t e U . S . D E P A R T M E N T O F E N E R G Y T h e c o v e r d e p i c t s v a r i o u s D O E m i s s i o n - r e l e v a n t g e n o m e s e q u e n c i n g t a r g e t s o f t h e D O E J o i n t G e n o m e I n s t i t u t e . D O E J G I M i s s i o n T h e U . S . D e p a r t m e n t o f E n e r g y J o i n t G e n o m e I n s t i - t u t e , s u p p o r t e d b y t h e D O E O f f i c e o f S c i e n c e , u n i t e s t h e e x p e r t i s e o f f i v e n a t i o n a l l a b o r a t o r i e s - L a w r e n c e B e r k e l e y , L a w r e n c e L i v e r m o r e , L o s A l a m o s , O a k R i d g e , a n d P a c i f i c N o r t h w e s t - a l o n g w i t h t h e H u d s o n A l p h a I n s t i t u t e f o r B i o t e c h n o l o g y t o a d v a n c e g e n o m i c s i n s u p p o r t o f t h e D O E m i s s i o n s r e l a t e d t o b i o e n e r g y , c a r b o n c y c l i n g , a n d b i o g e o c h e m i s t r y . J G I , l o c a t e d i n W a l n u t C r e e k , C a l i f o r n i a , p r o v i d e s i n t e g r a t e d

250

Overview of QAST 2009 , P.R. Comas1  

E-Print Network [OSTI]

,mostefa}@elda.org 4 NLE Lab. - ELiRF Research Group (UPV). Spain {prosso,dbuscaldi}@dsic.upv.es Abstract This paper Search and Retrieval; H.3.4 Systems and Software General Terms Experimentation, Performance, Measurement application of search in speech requires the transcriptions to be produced automatically, and the Automatic

Rosso, Paolo

251

Equipamentos Adquiridos com Recursos CAPES Pr-Equipamentos  

E-Print Network [OSTI]

@yahoo.com (21)2629-2696 Engenharia Civil Câmera infra-vermelha da Marca CAMERA FLIR SC620 Faculdade de

Souza, Max O.

252

N ffi d'ordre : 1865 pr'esent'ee  

E-Print Network [OSTI]

''equipe de probabilit'es de l'universit'e de Rennes, pour m'avoir communiqu'e le gout des statistiques. Je

LeGland, François

253

About PR Newswire Contact PR Newswire PR Newswire's Terms of Use Apply Careers Privacy Site Map RSS Feeds Copyright 1996-2010 PR Newswire Association LLC. All Rights Reserved.  

E-Print Network [OSTI]

company. Search Advanced Search Products & Services News Releases Send a release Member sign in Become 28 /PRNewswire-Asia/ -- Green building materials company Vecor Group has been selected as a finalist for the Credit Suisse Technopreneur Award, handed to the company that best applies a technology with the greatest

254

CUNY GRADUATe PROGRAMS graduate ceNter PrOgrams  

E-Print Network [OSTI]

CRT 0305 American Studies ADV CRT 0313 Anthropology PHD, MPHIL 2202 Art History PHD, MPHIL 1003 Educational Psychology - School PHD, MPHIL 0822 Engineering: Biomedical Engineering PHD, MPHIL 0905 Engineering: Chemical Engineering PHD, MPHIL 0906 Engineering: Civil Engineering PHD, MPHIL 0908 Engineering

Dennehy, John

255

Campus Curitibanos -Servio Social Pr-reitora de Assuntos Estudantis  

E-Print Network [OSTI]

Leandro Rodrigo dos Santos 9273060 Linconl Araújo 9273063 Luiz Fernando Zortéa 10103702 Magaiver Gindri Elzevir Ribeiro dos Santos 10103682 Fernanda Jungbluth 11202171 Gabriel Goeten de Lima 9273031 Gabriel Sartor 10206483 Gabrieli Ferreira 11202173 Gilmar Ricardo Camuzzato 10206560 Gilmário Vilela Santos

Floeter, Sergio Ricardo

256

Microsoft Word - PR1312_M2W1.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

21, 2012 CONTACT: Teresa Waugh, 503-230-7536 Doug Johnson, 503-230-5840 Or 503-230-5131 BPA to meet with public for feedback on proposed transmission system upgrades Portland,...

257

Microsoft Word - PR 12 13 Hooper Springs DEIS Public Meeting  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

needs in southeast Idaho and northwestern Wyoming. The line would run from a proposed new BPA Hooper Springs Substation near the city of Soda Springs, Idaho, to a proposed BPA...

258

ClRe GiOuPr Journal of DISCOVERY  

E-Print Network [OSTI]

Center researcher Sherry Chow, PhD, and colleagues have discovered antioxidants in green tea that can of the huge variety of work under way here. Read about green tea as a cancer preventive agent, exciting of Regents. The University of Arizona is an EEO/AA ­ M/W/D/V Employer. 2 | Going Green | Arizona Cancer

Arizona, University of

259

142pr glass seeds for the brachytherapy of prostate cancer  

E-Print Network [OSTI]

....................................................... 48 V-1 Preparation of experiment................................................................... 48 V-2 Nuclear Science Center Reactor (NSCR)........................................... 51 V-3 Neutron activation... Society 2006), after skin cancer, and the second leading cause of cancer-related death in men in the United States. Between 1988 and 1992, prostate cancer incidence rates increased dramatically due to earlier diagnosis with prostate-specific antigen...

Jung, Jae Won

2007-09-17T23:59:59.000Z

260

21 a 26 de Maio de 2000 CURITIBA (PR) -BRASIL  

E-Print Network [OSTI]

IN ELECTRIC OPERATIONAL AND EXPANSION PLANNING Capacity Payments and Supply Adequacy in Competitive Electricity Markets1 Shmuel S. Oren2 University of California at Berkeley USA 1 This paper benefited from a workshop on the subject of capacity payment that motivated this work and from the presentations of Larry

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

UNIVERSIDADE FEDERAL DE SANTA CATARINA PR-REITORIA DE GRADUAO  

E-Print Network [OSTI]

­ certificado militar atualizado (para candidatos do sexo masculino); IV ­ atestado de vacinação contra rubéola (para candidatas do sexo feminino até 40 anos ­ Lei nº 10.196/1996/SC); V ­ declaração negativa

Floeter, Sergio Ricardo

262

Progress Update: P&R Reactor Stacks Demolition  

ScienceCinema (OSTI)

October 2010 progress update of the Recovery Act at work at the Savannah River Site. The demolition of nuclear reactor stacks and filling the reactors with grout to reduce the site footprint.

Cody, Tom

2012-06-14T23:59:59.000Z

263

H-1B, O-1 & PR Beneficiary Information for all H-1B, O-1 & PR applications  

E-Print Network [OSTI]

diploma, transcripts, publications, marriage or birth certificates or letters of recommendation, Middle) 2. Other names used, including maiden names and any Anglicized names. 3. Date of birth (mm/dd/yyyy) 4. Gender 5. U.S. Social Security Number 6. Country of birth 7. Province of birth 8. Country

Scharer, John E.

264

BACHELOR OF SCIENCE IN GEOLOGY CATALOG 131 Fall (Th-Pr) Cr Spring (Th-Pr) Cr  

E-Print Network [OSTI]

106 Historical Geology (3-3) 4 MATH 151 Engineering Math. I (3-2) 4 MATH 152 Engineering Math. II (3-0) 3 GEOL 309 Introduction to Geologic Field Methods (1-6) 3 MATH 251 Engineering Math. III (3-0) 3-3) 4 GEOL 305 Paleobiology (2-3) 3 GEOL 312 Structural Geology and Tectonics (3-3) 4 U.S. history

265

trinity-aa-use-case-v1.2a  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Trinity Trinity Use Case Scenarios ( SAND 2 013---2941 P U nclassified, U nlimited R elease) Page 1 of 9 Trinity / N ERSC---8 U se C ase S cenarios April 5 , 2 013 This d ocument p rovides a dditional v iews o f a nticipated u sage s cenarios f or t wo o f the a dvanced a rchitecture f eatures o f T rinity, t he b urst b uffer a nd p ower/energy measurement a nd c ontrol. T his d ocument m ay c hange as our understanding of needs a nd t echnologies e volves. T hese scenarios are not intended to include all intended u ses o f t hese t echnologies. Format: E mbedded i n t he p rimary s cenario d escriptions a re n umbered t ags r eferring t o requirements ( listed f ollowing e ach s cenario) t hat a re i nferred b y t he s cenario. T he r eader should r ead t he s pecific r equirement, s pecified b y n umber, a t t he t ime i t i s e ncountered

266

THREE LECTURES ON MACROSCOPIC ASPECTS OF NUCLEAR DYNAMICS  

E-Print Network [OSTI]

would have been found: M A A m Vim a where M^ = pR /)l [12].a damped harmonic oscillator: V*m *m Vim = " The motion is

Swiatecki, W.J.

2010-01-01T23:59:59.000Z

267

1.2 MVA High-Tc Superconducting Fault Current Limiter  

Science Journals Connector (OSTI)

A 3-phase high Tc superconducting fault current limiter with a rated power of 1.2 ... a special partial melt process. The nominal current and voltage of the device are 70 ... 3-phase short circuit tests with a pr...

W. Paul; M. Chen; M. Lakner; J. Rhyner; L. Widenhorn

1998-01-01T23:59:59.000Z

268

Fixation of atmospheric CO[sub 2] by a series of hydroxo complexes of divalent metal ions and the implication for the catalytic role of metal ion in carbonic anhydrase. Synthesis, characterization, and molecular structure of [LM(OH)][sub n] (n = 1 or 2) and LM([mu]-CO[sub 3])ML (M(II) = Mn, Fe, Co, Ni, Cu, Zn; L = HB(3,5-iPr[sub 2]pz)[sub 3])  

SciTech Connect (OSTI)

By using the hindered tris(pyrazoly)borate ligand HB(3,5-iPr[sub 2]pz)[sub 3], (hydrotris(3,5-diisopropyl-1-pyrazolyl)-borate), a series of hydroxo complexes of first-row divalent metal ions (Mn (1), Fe (2), Co (3), Ni (4), Cu (5), Zn (6)) was synthesized. X-ray crystallography was applied to 1-5, establishing that all these hydroxo complexes have a dinuclear structure solely bridged with a bis(hydroxo) unit. The structure of 6 was characterized by spectroscopy, which indicates that 6 is monomeric. All these hydroxo complexes were found to react with CO[sub 2], even atmospheric CO[sub 2], to afford [mu]-carbonato dinuclear complexes of Mn (7), Fe (8), Co (9), Ni (10), Cu (11), and Zn (12). The molecular structures of the complexes 8-12 were determined. A variety of coordination modes of the carbonate group was seen. In 10 and 11, the carbonate group is bound to both metal centers bidentately in a symmetric fashion, while in 8 and 9, the carbonate coordination modes are described as an unsymmetric bidentate. The carbonate group in 12 is coordinated to one zinc ion bidentately, but it is bound to the other zinc ion unidentately. From IR data, the coordination mode of the carbonate group in 7 was suggested to be similar to those found in 8 and 9. Thus, the order of the coordination distortions of the carbonate groups in this series of [mu]-carbonato dinuclear complexes is determined. 40 refs., 8 figs., 4 tabs.

Kitajima, Nobumasa; Hikichi, Shiro; Tanaka, Masako; Moro-oka, Yoshihiko (Tokyo Inst. of Technology, Yokohama (Japan))

1993-06-30T23:59:59.000Z

269

Grooving Down the Helix http://www.bnl.gov/bnlweb/pubaf/pr/PR_display.asp?prID=1038&template=Today[12/7/2009 9:39:49 AM  

E-Print Network [OSTI]

the Helix - 12/4/2009 Brookhaven Hosts ATLAS Jamboree in Anticipation of LHC Second Run - 12 move in a straight line parallel to the DNA axis or trace more complex helical paths, following

Heller, Eric

270

ch2pr Page 1 of 9 http://www.jbpub.com/fox/supplementalproblems/ch2pr.htm 11/18/2003  

E-Print Network [OSTI]

,2-dimethylcyclohexene 2.19 The compound with the higher (or more exothermic) heat of combustion is the less stable: a. 1. Most hydrocarbons have a quite small dipole moment. The resonance structure pictured is quite/18/2003 2.24 The higher heat of hydrogenation will belong to the less stable isomer: a. 3,3-dimethyl-1

Walba, David

271

Synthesis and reactivity of sterically congested metallacyclobutenes and metal-mediated carbon-sulfur bond activation  

E-Print Network [OSTI]

assigned to the (C! C) stretch. iPr N i Pr N N i Pr -COD + 2 [Ni(COD) 2 ] N iPrN iPr iPr N Ni Ni iPr iPr iPr N N iPr N Ni iPr N iPr Scheme

Vlez, Carmen L.

2011-01-01T23:59:59.000Z

272

Microsoft Word - MillerBaldTaftPR_Lines_CX Memo.doc  

Broader source: Energy.gov (indexed) [DOE]

4, 2013 4, 2013 REPLY TO ATTN OF: KEC-4 SUBJECT: Environmental Clearance Memorandum Dave Tripp Project Manager - TEP-CSB-1 Proposed Action: Bald Mountain, Miller Peak, Lines Creek, and Taft Passive Repeater Communication Upgrades Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.19 Microwave, meterological amd radio towers Location: Mineral and Missoula counties, Montana; Shoshone County, Idaho Proposed by: Bonneville Power Administration (BPA) Description of the Proposed Action: BPA proposes to replace the analog communication system with a new digital communication system at four existing communication sites in Montana and Idaho to enable the connection of the digital circuits and ensure communication reliability. All of the sites are located on land managed by

273

Microsoft Word - PR 22 13 Kalispell-Kerr Public Meeting w photo...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

reliable electrical service and to reduce potential safety risks to the public and work crews. By rebuilding aging transmission lines when needed, BPA preserves the value of...

274

Microsoft Word - PR 13 13 Lane-Wendson Public Meeting _REVISED...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

reliable electric service and to reduce potential safety risks to the public and work crews. BPA preserves the value of its transmission system by rebuilding aging...

275

Microsoft Word - PR 01 13 BPA to meet with public for feedback...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

reliable electrical service and to reduce potential safety risks to the public and work crews. By rebuilding aging transmission lines when needed, BPA preserves the value of...

276

Microsoft Word - PR 02 13 Salem-Albany Public Meeting.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

reliable electric service and to reduce potential safety risks to the public and work crews. BPA preserves the value of its transmission system by rebuilding aging...

277

Microsoft Word - PR 31 13 Hills Creek-Lookout Public Meeting...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

roads or trails. The rebuild would reduce potential safety risks to the public and work crews. By rebuilding aging transmission lines when needed, BPA preserves the value and...

278

Universidade Federal do Paran Pr-Reitoria de Graduao e Educao Profissional  

E-Print Network [OSTI]

INICIAIS DA ESCOLA, NO BRASIL REFER?NCIAS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 01 Regina Maria Michelotto ARTIGO 2 EXPANS?O DA EDUCA??O SUPERIOR NO BRASIL: PANORAMA E PERSPECTIVA SUPERIOR NO BRASIL

Paraná, Universidade Federal do

279

S C |OPr|=|OPl| = p PrOS = (0 < < ) |OS|= r  

E-Print Network [OSTI]

;Tkr Tsr = KCr vk SCr vs = vs vk KCr SCr , Tkl Tsl = KCl vk SCl vs = vs vk KCl SCl Tkl Tsl = Tkl Tsl vs vk KCr SCr = vs vk KCl SCl KCr SCr = KCl SCl SKCrCL KCr SCr = KCl SCl sin KSCr = sin KSCl 9 #12;5 PlSPr PlSPr [ ] Tk Ts Tk Ts Tkr Tsr Tkl Tsl Tkr Tsr Tkr Tsr Tkr Tsr = vs vk KCr SCr = vs vk sin KSPr

Tamaru, Hiroshi

280

Abstract PR1: Hepatocellular carcinoma research and prevention in South Texas: The imperative  

Science Journals Connector (OSTI)

...Texas (P30-CA54174), the Susan G. Komen Breast Cancer Foundation (POP 2000 704), and the National Cancer Institute, Redes En Accion (U01-CA86117). Citation Information: Cancer Res 2011;71(24 Suppl):Abstract nr P2-14-04.

Amelie G. Ramirez; Nancy S. Weiss; Alan E. Holden; Lucina Suarez; Sharon P. Cooper; Edgar Munoz; Susan L. Naylor

2011-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

and University of Reims Summary: The probability density function of the area of the hyperbolic planar a probability density function ____ss____2. 2T cosh(ssx_T) L'evy's proof based on spectral theory is reproduced in Ikeda & Watanabe book. * *A different Gaussian proof

Université Pierre-et-Marie-Curie, Paris 6

282

Pattern Recognition 40 (2007) 796806 www.elsevier.com/locate/pr  

E-Print Network [OSTI]

distance measure between probability density functions. We propose to optimize the Information Cut using; Information theory; Parzen window density estimation; Clustering; Gradient descent optimization; Annealing 1 into subsets. Several text- books provide surveys of traditional clustering techniques, see e.g. Refs. [1

Slatton, Clint

283

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

) "Zti-1 * * (Wti Wti-1) , together with the final data "Ytssn= g(Xsstn). Of course, given (Y= (ti ti-1) E Yti(Wti Wti-1)jFti-1 ss ss ss ss

Université Pierre-et-Marie-Curie, Paris 6

284

Relationship Between Heat Flows and Geological Structures in the Sichuan Basin, P.R. China  

SciTech Connect (OSTI)

Based on an extensive data collection and analysis, this research has provided reliable representations of the features of the geothermal fields, their heat flow, and relationships with geological structures in the Sichuan Basin. The isotherms below a depth of 1,000 m show high values in the Central Uplift and the Southwest Uplift, and low values in the Northwest and Southeast Depressions. These features probably indicate undulation of crystalline basement and structural depression. At depths greater than 3,000 m, the isotherms tend to become simpler and regionalized. The mean heat flow in the basin is 69.1 mW/m{sup 2}. In the Central Uplift, the Northwest Depression and the East of the basin, heat-flow values range from 58.6 to 71.2 mW/m{sup 2}, with a mean value of 66.1 mWE/m{sup 2}. In the south and southwest, it varies from 76.6 to 100.5 mW/m{sup 2}, with a mean value of 86.2 mW/m{sup 2}. High heat-flow values occur within the uplift of the crystalline basement in the southwest Sichuan, and the heat flow decreases from the south, through the central area, to the northwest.

Zeng, Y.; Yu, H.; Wang, X.

1995-01-01T23:59:59.000Z

285

Magnetism and superconductivi[t]y in Pr-based filled skutterudite arsenides  

E-Print Network [OSTI]

5.11: Zero ?eld electrical resistivity vs temperature ?(T )technique. The electrical resistivity ? vs temperature T5.3: The zero-?eld electrical resistivity ? vs temperature T

Sayles, Todd Allen

2008-01-01T23:59:59.000Z

286

{sup 222}Rn Measurements at Federal University of Technology (UTFPR, Curitiba, PR, Brazil)  

SciTech Connect (OSTI)

Numerous studies and reports indicate that the indoor radon inhalation by humans has to be considered as the main source of radiological hazard and probably the second most important cause of lung cancer after that of smoking. During the last decades, many countries have put considerable efforts into direct measurements and monitoring of {sup 222}Rn and its progeny exposure, as well as {sup 222}Rn concentration mapping. Present measurements were performed with an aim to study possible correlation between used construction materials and {sup 222}Rn indoor concentration levels. For this purpose, 50 Lexan track detectors were exposed in the air (indoor as well as outdoor) during two months (June and July) within the central region of Curitiba and Campo Largo (Parana St., Brazil). Since this period of the year is usually rather cold in the South of Brazil, exposition time was chosen to prevent possible saturation of alpha tracks. The second step of measurements was performed during the months of November, December and January, when 50 Lexan track detectors were exposed in the air (indoor and outdoor) within the same urban area. Achieved results are being compared with other experimental data.

Correa, Janine Nicolosi; Paschuk, Sergei A.; Fior, Loriane; Schelin, Hugo R.; Flores da Silva, Ruben D.; Poettker, Fabiana [Federal University of Technology-Paran, UTFPR, Av. Sete de Setembro, 3165, Curitiba, PR, 80230-901 (Brazil); Paula Melo, Vicente de [Institute of Radioprotection, IRD, CNEN, Av. Salvador Allende, Rio de Janeiro, RJ (Brazil)

2008-08-07T23:59:59.000Z

287

Didactique des langues, constitution de la parole et subjectivation Pr. Patrick Anderson  

E-Print Network [OSTI]

-2013) Le séminaire de 2012 accordait une attention particulière à l'ouvrage d'Akira MIZUBAYASHI, Une langue venue d'ailleurs, Paris, Gallimard, 2011. En nous appuyant sur ce que livre Mizubayashi concernant l d'une réflexion qui s'appuiera sur notre dernier ouvrage (à paraître) Une langue à venir nous

Jeanjean, Louis

288

Universidade Federal de Santa Catarina -UFSC Pr-Reitoria de Pesquisa e Ps-Graduao -PRPG  

E-Print Network [OSTI]

Rodrigo Carneiro da Costa Sim Rafael H. Lopez Rubia Bernadete P dos Santos * Antônio Edésio Jungles-2012 MESTRADO CANDITADO (A) Bolsa Orientador (a) Aline Selau Santos Não Glicério Trichês Alysson R. Gomes de. Thives Daniel Santos Taqueda Sim Marcos A Noronha Diego Antonio Custódio Não Enedir Ghisi Evandro Paulo

Floeter, Sergio Ricardo

289

UNIVERSIDADE FEDERAL DE SANTA CATARINA PR-REITORIA DE ASSUNTOS ESTUDANTIS  

E-Print Network [OSTI]

BIREAHLS 4. ALINE DOS SANTOS SOUZA 5. ALINE RIBEIRO DO PRADO 6. ALTIMAR JO?O MARSARO 7. ÁLVARO PANTALE?O CARNEIRO SOARES 21. CESAR S?TH NAKAMURA PEREIRA 22. CRISLAINE DANIELE WEBER DOS SANTOS 23. CRISTIAN CARVALHO 33. EVERTON JOS? CARDOSO 34. EWERTON PAZINI SEBEM 35. FABIANE SARTOR GRANEMANN 36. FABIANE SARTOR

Floeter, Sergio Ricardo

290

Duc Nguyen-Manh, S.L. Dudarev CCFE-PR(14)07  

E-Print Network [OSTI]

to radiation swelling and grain boundary embrittlement, is a major factor limiting the lifetime of structural and hydrogen. Effects associated with the incorporation of other inert gases have not received much attention

291

Technical Note PR-TN-2004/00370 Issued: 05/2004  

E-Print Network [OSTI]

in the existing Amsterdam Hypermedia Model (AHM) and Adaptive Hypermedia Application Model (AHAM). Although we

de Vries, Arjen P.

292

E-Print Network 3.0 - autoanti-pr cold agglutinin Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

N-acetylglucosamine;GNA, Galanthus nivalis agglutinin; Jacalin,jackfruit agglutinin;LCA, Lens... fluoride; PNA, peanut agglutinin; SDS-PAGE, sodium dodecyl...

293

Linarisation des amplificateurs de puissance par pr-distorsion avec prise en compte des effets mmoire  

E-Print Network [OSTI]

mémoire Geneviève BAUDOIN1, Pascale JARDIN1, Roman MARSALEK1,2 1ESYCOM - ESIEE - Laboratoire des Signaux effets de mémoire. Abstract ­ We present a baseband adaptive pre-distorion technique to linearize power-distortion system that is applied as a pre-distortion. The form of the pre-distorter is a polynomial with memory

Baudoin, Geneviève

294

THE USE OF PR IMARY UCULT I\\ AGI II,iG THE SOME PALAEARCTIC WADERS  

E-Print Network [OSTI]

of Novemben. The dun- ation of indivrdual moult is about 3 to 3i months (Tree in pnep, ). Finst yean binds.. be+,reen thesc two sets of f'eathers, but th i s contnast is nc,where ds !lred'. as that o{'the i

de Villiers, Marienne

295

PrOfeSSiOnaL certificate in SuStainaBiLityfOr  

E-Print Network [OSTI]

Examines environmental sustainability at a global and national level. Studies the Green Building movement and the development of the building rating systems. Provides core/foundational knowledge in Sustainability an increasingly significant core concept for the building industry. Green initiatives and practices continue

296

Chemical Expansion and Frozen-in Oxygen Vacancies in Pr-doped Ceria , S. R. Bishopa  

E-Print Network [OSTI]

, USA Doped CeO2 is a promising candidate for solid oxide fuel cell electrolyte and electrode-7). Acceptor doped ceria is regarded as a promising candidate for several applications as solid oxide fuel cell temperatures and reduction/oxidation behavior. In the fuel cell application, CeO2-based solid electrolytes

Yildiz, Bilge

297

Mechanical, Electrical, and Optical Properties of (Pr,Ce)O[subscript 2] Solid Solutions: Kinetic Studies  

E-Print Network [OSTI]

Praseodymium doped cerium oxide (PCO) shows mixed ionic and electronic conducting (MIEC) characteristics at relatively high pO2 (e.g. air) and enhanced oxygen storage capacity (OSC), of interest for solid oxide fuel cell ...

Chen, Di

298

Pui-Wai Ma and S. L. Dudarev CCFE-PR(12)03  

E-Print Network [OSTI]

to Physical Review B and is reproduced with their permission Further reproduction distribution of this paper is its magnetic moment, H is the effective field acting on an atomic spin, h is a fluctuating field linked to the itinerant nature of electron magnetism, where electron-electron exchange interaction

299

HIPAA Procedure 5111 PR.2 Protected Health Information: Physical Security & Environmental Supports  

E-Print Network [OSTI]

safeguards ...................................................................................................................1 Environmental Safeguards physical safeguards such that: departmental protected health information (ePHI & PHI in all formats

300

NAZARIO D. RAMIREZ-BELTRAN Industrial Engineering Department, University of Puerto Rico, Mayaguez, PR 00680  

E-Print Network [OSTI]

NAZARIO D. RAMIREZ-BELTRAN Industrial Engineering Department, University of Puerto Rico, Mayaguez Engineering, Texas A&M University 1988 M.S., Industrial Engineering, Texas A&M University 1983 B.S., Industrial Engineering, Instituto Tecnologico de Celaya, Celaya, Gto., México 1976 Quality Control Training

Gilbes, Fernando

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Chemical Expansion and Frozen-In Oxygen Vacancies in Pr-Doped Ceria  

E-Print Network [OSTI]

Doped CeO2 is a promising candidate for solid oxide fuel cell electrolyte and electrode applications because of its high ionic conductivity and reduction/oxidation behavior at intermediate temperatures. Its electronic and ...

Kuru, Yener

2011-01-01T23:59:59.000Z

302

GROUND UPBy Kathy Svitil 15S PR I NG 2012 ENGINEERING & SCIENCE  

E-Print Network [OSTI]

a challenge similar to Katrina's. I do oceanography . . . E&S: There's not a lot of that here. AT: Yes, that's exactly the point. It is not traditionally something Caltech has done, but there's a movement now rather than a risk. AT: It was certainly something that I thought about a lot. There is a strong

303

Universidade Federal de Santa Catarina -UFSC Pr-Reitoria de Pesquisa e Ps-Graduao -PRPG  

E-Print Network [OSTI]

que está em dia com o serviço militar para candidatos brasileiros do sexo masculino; - Cópia de sexo masculino; - Certificado válido em inglês

Floeter, Sergio Ricardo

304

Universidade Federal de Santa Catarina -UFSC Pr-Reitoria de Pesquisa e Ps-Graduao -PRPG  

E-Print Network [OSTI]

que está em dia com o serviço militar para candidatos brasileiros do sexo masculino; - Cópia de sexo masculino; - Certificado válido em inglês avan

Floeter, Sergio Ricardo

305

Dynamic (G2) Model Design Document, 24590-WTP-MDD-PR-01-002, Rev. 12  

SciTech Connect (OSTI)

The Hanford Tank Waste Treatment and Immobilization Plant (WTP) Statement of Work (Department of Energy Contract DE-AC27-01RV14136, Section C) requires the contractor to develop and use process models for flowsheet analyses and pre-operational planning assessments. The Dynamic (G2) Flowsheet is a discrete-time process model that enables the project to evaluate impacts to throughput from eventdriven activities such as pumping, sampling, storage, recycle, separation, and chemical reactions. The model is developed by the Process Engineering (PE) department, and is based on the Flowsheet Bases, Assumptions, and Requirements Document (24590-WTP-RPT-PT-02-005), commonly called the BARD. The terminologies of Dynamic (G2) Flowsheet and Dynamic (G2) Model are interchangeable in this document. The foundation of this model is a dynamic material balance governed by prescribed initial conditions, boundary conditions, and operating logic. The dynamic material balance is achieved by tracking the storage and material flows within the plant as time increments. The initial conditions include a feed vector that represents the waste compositions and delivery sequence of the Tank Farm batches, and volumes and concentrations of solutions in process equipment before startup. The boundary conditions are the physical limits of the flowsheet design, such as piping, volumes, flowrates, operation efficiencies, and physical and chemical environments that impact separations, phase equilibriums, and reaction extents. The operating logic represents the rules and strategies of running the plant.

Deng, Yueying; Kruger, Albert A.

2013-12-16T23:59:59.000Z

306

Magnetism and superconductivi[t]y in Pr-based filled skutterudite arsenides  

E-Print Network [OSTI]

in the conduction band The Josephson junction . . . . . .1.4: A diagram of a Josephson junction, consisting of tworings joined by two Josephson junctions. The current through

Sayles, Todd Allen

2008-01-01T23:59:59.000Z

307

Magnetism and superconductivi[t]y in Pr-based filled skutterudite arsenides  

E-Print Network [OSTI]

1.3 Magnetism . . . . .1.3.3 Itinerant Magnetism . . . . . . . . . . .3.3 Magnetism . . . . . . . . . . . . . . . . . . . . . 3.4

Sayles, Todd Allen

2008-01-01T23:59:59.000Z

308

Office of the PR E S I D E N T June 24, 2011  

E-Print Network [OSTI]

discussed were: - The Energy Management Plan ­ a system where the University borrows money to finance sustainability projects related to energy management and pays back the loan through energy savings a cyclotron which creates medical isotopes for treatments and research - The annual report from the auditor

MacMillan, Andrew

309

1. (F11PR) You are given: Year Oil Forward Price Zero Coupon ...  

E-Print Network [OSTI]

Apr 23, 2013 ... The price of 2 year oil swap which provides two barrels of oil at the end of one year and five barrels of oil at the end of two years is 137.60.

Jeff Beckley

2013-04-23T23:59:59.000Z

310

Microsoft Word - PR-09-13-20130304-Wanted-innovators-researchers...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

in 2013" for more information at the link. Under the oversupply policy, generators who elect to submit costs and supporting data are reimbursed for payments they would otherwise...

311

A First Course in Linear Optimization ReEx PrEsS  

E-Print Network [OSTI]

Many of the pictures in this book were found floating around on the web. I am making. fair use of them as they float through this document. Of course, I gratefully...

jonxlee

2013-12-13T23:59:59.000Z

312

Microsoft Word - PR-24-13-BPA-turns-science-educators-visions...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

grants From purchasing energy robotic kits to providing funds for the construction of small scale hydropower generators, the Bonneville Power Administration is partnering with...

313

Pr ufung aus Informatik 2 am 22. Oktober 1999 f ur Telematiker und Technische Mathematiker  

E-Print Network [OSTI]

) (BCD Codierung). ii. Entwickeln Sie daraus die Interpretationsfunktion f ur den Exze#25;-3-Code I exc3 Kodierung der Dezimalzi#11;ern (0 . . . 9) mittels des s.g. Exze#25;-3-Code. Entwickeln Sie die die Interpretationsfunktion f ur die normale Kodierung von Bin arzahlen I bcd (b 3 ; b 2 ; b 1 ; b 0

314

Pr ufung aus Informatik 2 am 4. Dezember 1998 f ur Telematiker und Technische Mathematiker  

E-Print Network [OSTI]

) mittels des s.g. Exze?­3­Code. Entwickeln Sie die Interpretationsfunktion I exc3 (b 3 ; b 2 ; b 1 ; b 0 normale Kodierung von Bin¨ arzahlen I bcd (b 3 ; b 2 ; b 1 ; b 0 ) (BCD Codierung). ii. Entwickeln Sie daraus die Interpretationsfunktion f¨ ur den Exze?­3­Code I exc3 (b 3 ; b 2 ; b 1 ; b 0 ). (b

315

Pr ufung aus Informatik 2 am 30. April 1999 f ur Telematiker und Technische Mathematiker  

E-Print Network [OSTI]

Kodierung der Dezimalziffern (0 . . . 9) mittels des s.g. Exze?­3­Code. Entwickeln Sie die Interpretationsfunktion f¨ ur die normale Kodierung von Bin¨ arzahlen I bcd (b 3 ; b 2 ; b 1 ; b 0 ) (BCD Codierung). ii. Entwickeln Sie daraus die Interpretationsfunktion f¨ ur den Exze?­3­Code I exc3 (b 3 ; b 2 ; b 1 ; b 0 ). (c

316

s pr i ng 2010 ENGINEERING & SCIENCE 41 Consider the following closed  

E-Print Network [OSTI]

the final state, and which will have the same entropy. Bill Tivol [BS '62] · · · Letters The syngas can in internal combustion (or even gas-fired turbine) engines a bit of a futile exercise if the energy conversion

317

E-Print Network 3.0 - aeg pruefreaktor pr-10 Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

GaAsIInGaAsP MQW()this result indicates that AE,AEg remains close to 0.4 for all the InGaAsP based lattice Source: Ecole Polytechnique, Centre de mathmatiques Collection:...

318

A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr...  

Office of Legacy Management (LM)

At estI&ho&in Rloomfield, Iw .Terney (.J. ' :I. Msr.ien) , (IL Fox, Site Y (Cyril Smith). and Nnt rolling work has been Gone at Joslyn Menufect;trl.ng nnti Sulri1.v Cosmeny,...

319

Magnetism and superconductivi[t]y in Pr-based filled skutterudite arsenides  

E-Print Network [OSTI]

H. J. Kang, J. W. Lynn, Pengcheng Dai, S. K. McCall, M. W.H. J. Kang, J. W. Lynn, Pengcheng Dai, S. K. McCall, M. W.H. J. Kang, J. W. Lynn, Pengcheng Dai, S. K. McCall, M. W.

Sayles, Todd Allen

2008-01-01T23:59:59.000Z

320

Visual Information Systems Pr. Robert Laurini Chapter VIII: Virtual 3D Cities 1  

E-Print Network [OSTI]

of urban noise, air pollution · Simulation of floods · Simulation of natural and technological hazard of advertising · Real estate agencies: give an idea of the vicinity · Tourism: landmarks to visit · Mobile phone

Laurini, Robert

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Visual Information Systems Pr. Robert Laurini Chapter V: Virtual 3D Cities 1  

E-Print Network [OSTI]

noise, air pollution · Simulation of floods · Simulation of natural and technological hazard of advertising · Real estate agencies: give an idea of the vicinity · Tourism: landmarks to visit · Mobile phone

Laurini, Robert

322

Submitted to the Annals of Applied Probability arXiv: math.PR/0000000  

E-Print Network [OSTI]

are the quickest detection of man- ufacturing defects during product quality assurance, online fault detection at the same time. These problems arise, for example, from managing product quality in manufacturing systems and preventing the spread of infectious diseases. The promptness and accuracy of detection rules improve greatly

Dayanik, Savas

323

Microsoft Word - PR-05-0213-Northern-PikeminnowSport-Reward-Program...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

saving salmon by participating in sport fishery Portland, Ore. - Heading into the first weekend of the 2013 Pikeminnow Sport-Reward Program, early reports indicate a...

324

Pr-Reitoria de Assuntos Estudantis Campus Prof. Joo David Ferreira Lima CEP 88040-900  

E-Print Network [OSTI]

11201427 ANA CLAUDIA SOUSA PEREIRA 11101755 ANA LARA SCHLINDWEIN DA SILVA 12100391 ANDERSON NASCIMENTO HAMER MARIAN 10201725 CANDINHO LUIZ D. BRIDA JUNIOR 11101975 CAROLINA CORREIA ALVES 12102254 CAROLINA ROSA 12102577 JACKSON ALVES DA SILVA 12101457 JEAN CARLOS PINHEIRO BORGES 12101231 JESSICA CARMEM TOEBE

Floeter, Sergio Ricardo

325

Table HC1-12a. Housing Unit Characteristics by West Census Region,  

U.S. Energy Information Administration (EIA) Indexed Site

2a. Housing Unit Characteristics by West Census Region, 2a. Housing Unit Characteristics by West Census Region, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total U.S. West Census Region RSE Row Factors Total Census Division Mountain Pacific 0.5 1.0 1.7 1.1 Total .............................................................. 107.0 23.3 6.7 16.6 NE Census Region and Division Northeast ..................................................... 20.3 -- -- -- NF New England ............................................. 5.4 -- -- -- NF Middle Atlantic ........................................... 14.8 -- -- -- NF Midwest ....................................................... 24.5 -- -- -- NF East North Central ..................................... 17.1 -- -- -- NF West North Central ....................................

326

CEC'99 Amor & Anumba Page 1 of 12 A SURVEY AND ANALYSIS OF INTEGRATED  

E-Print Network [OSTI]

such as the application area, development environment, modelling approaches used, reusability, hardware and software and Dr C. J. Anumba2 ABSTRACT This paper is concerned with the development of an integrated project approaches to its development. A detailed survey and analysis of recent UK projects that have sought

Amor, Robert

327

Acoustic Performance Analysis of Bionic Coupling Multi-layer Structure Yonghua Wang1,2,a  

E-Print Network [OSTI]

coefficients and analyze the influences of different parameters of each layer on absorption coefficients. Laboratory of Tribology and System Dynamics, Ecole Centrale de Lyon, Ecully 69134, France 3. Laboratory bionic method to develop a new sound absorption structure. Inspired by the coupling absorption structure

Boyer, Edmond

328

Notes 12. (a) Annular pressure (damper) seals, and (b) Hydrostatic journal bearings  

E-Print Network [OSTI]

Bearings ? Learn more See http://phn.tamu.edu/TRIBGroup Publications For complete list of computational model predictions and comparisons to test data (over 30 journal papers and 10+ technical progress reports to NASA, USAF, P&W, Rocketdyne, Snecma... Bearings for Oil-Free Turbomachinery,? Journal of Engineering for Gas Turbines and Power, (2007), 129(4), pp. 1020-1027. NOTES 12(b): HYDROSTATIC JOURNAL BEARINGS ? ? Dr. Luis San Andr?s (2009) 18 San Andr?s, L., S. Phillips and D. Childs, Static...

San Andres, Luis

2009-01-01T23:59:59.000Z

329

CEWEP -Confederation of European Waste-to-Energy Plants Boulevard Clovis 12A  

E-Print Network [OSTI]

Recovered Fuel) as a fuel in both cement kilns and power plants, dedicated Biomass Energy Plants (BEP; BEP ­ Biomass Energy Plants; LFG ­ Landfill Gas; WtE ­ Waste-to-Energy 1 Excluding agricultural is considered biomass, thus a renewable energy source. Summary of the overall development of Renewable Energy

330

Titania nanostructure arrays from lithographically defined templates Deying Xia,1,2,a  

E-Print Network [OSTI]

and Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, Massachusetts 02139,9 dye-sensitized solar cells,10 lithium-ion batteries,11 and superhydrophobic/ superhydrophilic

New Mexico, University of

331

Page 1 Vol. 18 No. 12 A Rutgers Cooperative Extension Publication  

E-Print Network [OSTI]

of crops where silicon nutrition helped to control powdery mildew disease in field trials and/or green as a liming material. For example, calcium silicate slag, a product produced during the manufacture of steel research has demonstrated that calcium silicate slag is an effec- tive liming material that it can

Goodman, Robert M.

332

3.12 A WILDLAND FIRE DYNAMIC DATA-DRIVEN APPLICATION SYSTEM Janice L. Coen  

E-Print Network [OSTI]

University of Colorado at Denver and Health Sciences Center, Denver, CO 3 University of Kentucky, Lexington- range forecast of wildfire behavior using a coupled atmosphere-fire model injected with real disparate data sources. The DDDAS is built upon a previously existing coupled atmosphere-wildfire model

Douglas, Craig C.

333

Anisotropic electrical resistivity during annealing of oriented columnar titanium films Nicolas MARTIN, 1,2 a)  

E-Print Network [OSTI]

1 Anisotropic electrical resistivity during annealing of oriented columnar titanium films Nicolas of anisotropic electrical resistivity versus temperature of titanium thin films. An oriented titanium film (1 µm. The average DC electrical resistivity changes from 6.03?10-6 to more than 2.40?10-1 m with the increasing

Paris-Sud XI, Université de

334

What is the fate of runaway positrons in tokamaks? Hong Qin,1,2,a)  

E-Print Network [OSTI]

positrons have been generated in accelerators for scien- tific research, in nuclear reactors or on the first wall of the vacuum chamber? Because the annihilation probability dependents on the path and veloc to runaway velocity by the loop voltage. In the toroidal direction, the runaway positrons are accelerated

335

Table HC1-2a. Housing Unit Characteristics by Year of Construction,  

U.S. Energy Information Administration (EIA) Indexed Site

2a. Housing Unit Characteristics by Year of Construction, 2a. Housing Unit Characteristics by Year of Construction, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total Year of Construction RSE Row Factors 1990 to 2001 1 1980 to 1989 1970 to 1979 1960 to 1969 1950 to 1959 1949 or Before 0.5 1.6 1.2 1.0 1.1 1.1 0.8 Total ............................................... 107.0 15.5 18.2 18.8 13.8 14.2 26.6 4.3 Census Region and Division Northeast ...................................... 20.3 1.5 2.4 2.1 2.8 3.0 8.5 8.8 New England .............................. 5.4 0.4 0.7 0.4 0.8 0.9 2.3 11.3 Middle Atlantic ............................ 14.8 1.1 1.7 1.7 2.0 2.2 6.2 11.2 Midwest ......................................... 24.5 2.8 3.7 3.6 2.9 3.5 8.1 10.2 East North Central ...................... 17.1 2.0 2.5 2.5 2.0 2.6 5.5 11.9

336

Pr-Reitoria de Pesquisa e Ps-Graduao -PROPPG Programa de Ps-Graduao em Desenvolvimento Regional -PPGDR  

E-Print Network [OSTI]

- Brasil) Prof. Dr. José Cadima Ribeiro (Universidade do Minho - Portugal) Prof. Dr. Jorge Luiz Alves Natal (UFRJ - RJ - Brasil) Prof. Dr. Jose Antonio Fialho Alonso (FEE - RS - Brasil) Prof. Dr. José Eduardo Faria (USP - SP - Brasil) Prof. Dr. Luiz Felipe Nascimento (UFRGS - RS - Brasil) Prof. Dr. Martin Coy

Paris-Sud XI, Université de

337

Pr'esentation du milieu ''Je ne concois pas quel gout vos gens d'Europe ont pour  

E-Print Network [OSTI]

, Surinam, et Guyane Fran¸caise). Son origine g'eodynamique est commune `a celle du craton Ouest Africain

Sailhac, Pascal

338

DOE_EE0003592_HEL-SR-PR-0027 Rev 1 20130227 Final Report_Public Release  

SciTech Connect (OSTI)

To develop a high temperature Thermal Storage System (TES) based on graphite and able to provide both economical and technical advantages with respect to existing solutions contributing to increase the share of Concentrated Solar Plants (CSP).

Eduardo Villarroel, Carlos Fernandez-Pello, Jeff Lenartz, Karen Parysek

2013-02-27T23:59:59.000Z

339

Site characterization plan: Conceptual design report: Volume 5, Appendices P-R: Nevada Nuclear Waste Storage Investigations Project  

SciTech Connect (OSTI)

The site for the prospective respository is located at Yucca Mountain in southwestern Nevada, and the waste emplacement area will be constructed in the underlying volcanic tuffs. The target horizon for waste emplacement is a sloping bed of densely welded tuff more than 650 ft below the surface and typically more than 600 ft above the water table. The conceptual design described in this report is unique among repository designs in that it uses ramps in addition to shafts to gain access to the underground facility, the emplacement horizon is located above the water table, and it is possible that 300- to 400-ft-long horizontal waste emplacement boreholes will be used. This report summarizes the design bases, design and performance criteria, and the design analyses performed. The current status of meeting the preclosure performance objectives for licensing and of resolving the repository design and preclosure issues is presented. The repository design presented in this report will be expanded and refined during the advanced conceptual design, the license application design, and the final procurement and construction design phases. Volume 5 contains appendices P through R.

MacDougall, H.R.; Scully, L.W.; Tillerson, J.R. (comps.)

1987-09-01T23:59:59.000Z

340

Quantitative Peptidomics Study Reveals That a Wound-Induced Peptide from PR-1 Regulates Immune Signaling in Tomato  

Science Journals Connector (OSTI)

...asterisks (P 0.001) based on Students t test. Bioactivity of CAPE1 CAPE1 treatment...or ***P 0.001, based on Students t test. The antiherbivore response was evaluated...peptide solution has been used previously to test the bioactivity of systemin (Schaller...

Ying-Lan Chen; Chi-Ying Lee; Kai-Tan Cheng; Wei-Hung Chang; Rong-Nan Huang; Hong Gil Nam; Yet-Ran Chen

2014-10-31T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Quantitative Peptidomics Study Reveals That a Wound-Induced Peptide from PR-1 Regulates Immune Signaling in Tomato  

Science Journals Connector (OSTI)

...J., Pan, H., Biswas, R., Fricker, L.D. (2005). Quantitative neuropeptidomics of microwave-irradiated mouse brain and pituitary. Mol. Cell. Proteomics 4 : 1391-1405. Chen, C.J., Chen, W.Y., Tseng, M.C., Chen, Y.R...

Ying-Lan Chen; Chi-Ying Lee; Kai-Tan Cheng; Wei-Hung Chang; Rong-Nan Huang; Hong Gil Nam; Yet-Ran Chen

2014-10-31T23:59:59.000Z

342

Uncoupling PR Gene Expression from NPR1 and Bacterial Resistance: Characterization of the Dominant Arabidopsis cpr6-1 Mutant  

Science Journals Connector (OSTI)

...physiological immunity in plants Church G.M. Gilbert W. Genomic sequencing Crute, I.R...cyclophilin D | Arabidopsis genetics microbiology physiology Arabidopsis Proteins Carrier...Isomerase genetics Plant Diseases genetics microbiology Plant Proteins genetics Pseudomonas...

Joseph D. Clarke; Yidong Liu; Daniel F. Klessig; Xinnian Dong

343

Abstract PR-04: Curcumin is an effective chemopreventive substance for betel quid chewer's oral precancer in Sri Lanka.  

Science Journals Connector (OSTI)

...Eleventh Annual AACR International Conference on Frontiers...chewer's oral precancer in Sri Lanka. Itsuo Chiba 1...Japan, 3 Army Hospital, Sri Lanka, Colombo, Sri...chewer's oral precancer in Sri Lanka. [abstract...Eleventh Annual AACR International Conference on Frontiers...

Itsuo Chiba; Maiko Takeshima; Yoshihiro Abiko; Hiroshi Kobayashi; Malsantha Muthumala; Chihiro Sugiura; Makiko Onodera; Shibata Toshiyuki; Hirofumi Matsuoka; Naoki Kakudate; Shunichi Fukuhara; and Toshio Takiguchi

2012-11-01T23:59:59.000Z

344

Quantitative Peptidomics Study Reveals That a Wound-Induced Peptide from PR-1 Regulates Immune Signaling in Tomato  

Science Journals Connector (OSTI)

...Academia Sinica, Taipei 11529, Taiwan b Department of Life Science and Institute of Plant Biology, National Taiwan University...d Department of New Biology, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711-873, Republic of Korea e Department...

Ying-Lan Chen; Chi-Ying Lee; Kai-Tan Cheng; Wei-Hung Chang; Rong-Nan Huang; Hong Gil Nam; Yet-Ran Chen

2014-10-31T23:59:59.000Z

345

Pr-requis pour l'entre l'Universit Douady et al. Un dispositif pour alerter les tudiants sur  

E-Print Network [OSTI]

, enseignants-chercheurs H. Borderiou, ingénieur développement et support internet et intranet au SIMSU Grenoble année de licence sciences et technologies (13 parcours pour environ 1000 étudiants), sur leur niveau de

Ycart, Bernard

346

Quantitative Peptidomics Study Reveals That a Wound-Induced Peptide from PR-1 Regulates Immune Signaling in Tomato  

Science Journals Connector (OSTI)

...for Authors ( www.plantcell.org ) is: Yet-Ran Chen ( yetran@gate.sinica.edu.tw ). [W] Online version contains Web-only data. [OPEN] Articles can be viewed online without a subscription. CAPE1, a conserved peptide elicitor derived from...

Ying-Lan Chen; Chi-Ying Lee; Kai-Tan Cheng; Wei-Hung Chang; Rong-Nan Huang; Hong Gil Nam; Yet-Ran Chen

2014-10-31T23:59:59.000Z

347

Field-dependent ordered phases and Kondo phenomena in the filled skutterudite compound PrOs4As12  

Science Journals Connector (OSTI)

...Frederick P.-C. Ho J. R. Jeffries T. A. Sayles T. Yanagisawa W. M. Yuhasz Songxue Chi H. J. Kang J. W. Lynn Pengcheng Dai S. K. McCall M. W. McElfresh M. J. Fluss Z. Henkie A. Pietraszko Department of Physics, Institute for...

M. B. Maple; N. P. Butch; N. A. Frederick; P.-C. Ho; J. R. Jeffries; T. A. Sayles; T. Yanagisawa; W. M. Yuhasz; Songxue Chi; H. J. Kang; J. W. Lynn; Pengcheng Dai; S. K. McCall; M. W. McElfresh; M. J. Fluss; Z. Henkie; A. Pietraszko

2006-01-01T23:59:59.000Z

348

Chemomechanical properties and microstructural stability of nanocrystalline Pr-doped ceria: An in situ X-ray diffraction investigation  

E-Print Network [OSTI]

applications such as solid oxide fuel cell (SOFC) components [5], oxygen sensors [6] and catalysts [7 melting point and simple fluorite structure [1,2]. In the fuel cell application, CeO2-based oxides f o Article history: Received 4 December 2010 Received in revised form 11 March 2011 Accepted 25

Yildiz, Bilge

349

GRK2-Dependent S1PR1 Desensitization Is Required for Lymphocytes to Overcome Their Attraction to Blood  

Science Journals Connector (OSTI)

...10739680802026076 18608990 7 Lo C. G. Xu Y. Proia R. L. Cyster J. G. , Cyclical modulation...jlb.0403136 14761932 13 Watterson K. R. ., Dual regulation of EDG1/S1P...1074/jbc.M610318200 17237497 15 Pappu R. ., Promotion of lymphocyte egress...

Tal I. Arnon; Ying Xu; Charles Lo; Trung Pham; Jinping An; Shaun Coughlin; Gerald W. Dorn; Jason G. Cyster

350

Journal of The Electrochemical Society, 158 (12) A1461-A1477 (2011) A1461 0013-4651/2011/158(12)/A1461/17/$28.00 The Electrochemical Society  

E-Print Network [OSTI]

Reformulation and Simulation of Electrochemical-Thermal Behavior of Lithium-Ion Battery Stacks Paul W. C-isothermal lithium-ion pseudo 2-D battery model. The transformed model is then conveniently discretized using operation of an 8-cell battery stack subject to varying heat transfer coefficients as well as specified

Subramanian, Venkat

351

file://C:\Documents%20and%20Settings\VM3\My%20Documents\hc6-12a  

U.S. Energy Information Administration (EIA) Indexed Site

2a. Usage Indicators by West Census Region, 2a. Usage Indicators by West Census Region, Million U.S. Households, 2001 ____________________________________________________________________________________________ | | | | | West Census Region | | |___________________________________| | | | | | | | Census Division | | | |_______________________|

352

Data:12a700f2-b169-42ae-bcdf-25646587ea4b | Open Energy Information  

Open Energy Info (EERE)

-b169-42ae-bcdf-25646587ea4b -b169-42ae-bcdf-25646587ea4b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Loup River Public Power Dist Effective date: 2013/01/15 End date if known: Rate name: District Owned Lighting EMH 11000 Sector: Commercial Description: Source or reference: http://www.loup.com/customersvc/rates.asp Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

353

Data:12a45141-7972-4ec8-a2dc-37fedc8133d3 | Open Energy Information  

Open Energy Info (EERE)

5141-7972-4ec8-a2dc-37fedc8133d3 5141-7972-4ec8-a2dc-37fedc8133d3 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Ameren Illinois Company Effective date: 2010/11/19 End date if known: Rate name: DS-2 Zone 2 - Small General Delivery Service 600V to 15kV Sector: Commercial Description: AVAILABILITY Service under this Rate is available for any eligible Non-Residential Customer within the territory served by Company that meets the following criteria: Customers served under this Rate shall have a maximum monthly Demand of less than 150 kilowatts (kW) as qualified in the Delivery Service Rate Reassignment section. A Customer without a demand meter installed, but with an average usage of less than 1,200 kWh per day during each monthly billing period will be normally assumed to have a maximum monthly Demand of less than 150 kW. Where Customer's average daily usage is 1,200 kWh per day or more in any monthly billing period, Company may install a demand meter at Company's expense to determine if Customer remains eligible for service under this Rate.

354

Structure and stoichiometry of ,,0001... 4HSiC/oxide interface Xingguang Zhu,1,2,a  

E-Print Network [OSTI]

polytype of silicon carbide SiC is a promising candidate for high temperature and high power metal that hampers SiC device applications. The nature of the transition region stoichiometry and structure need beneath the SiC/SiO2 interface, setting limits on the previously predicted nonstoichiometric transition

Garfunkel, Eric

355

Funding for state, city, and county governments in the state...  

Broader source: Energy.gov (indexed) [DOE]

PR Moca City 182,800 PR Ponce City 1,765,300 PR Rio Grande City 519,200 PR San German City 162,200 PR San Juan City 4,392,500 PR San Lorenzo City 182,200 PR San...

356

Nuclear Structure and Nuclear Reactions | Argonne Leadership...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the ab initio no-core full configuration approach," Phys. Rev. C 86, 034325 (2012) Nuclear Structure and Nuclear Reactions PI Name: James Vary PI Email: jvary@iastate.edu...

357

Ineq~liriesin SfarisricsondPrWiliry IMS Lecture Notes-Monograph SeriesVol. 5(19U4).41-53  

E-Print Network [OSTI]

of these inequalities.The mird givesconjecturesandquestions.Someof thtsehavebewrp~eviwslystated;mostarcnew. 1

Cohen, Joel E.

358

New measurement of cross section of evaporation residues from $^{\\textrm{nat}}$Pr+$^{12}$C reaction: A comparative study on the production of $^{149}$Tb  

E-Print Network [OSTI]

Production cross sections of evaporation residues, $^{149}$Tb, $^{150}$Tb, $^{151}$Tb and $^{149}$Gd, have been measured using the stacked foil technique followed by off-line $\\gamma$-spectrometry in $^{12}$C induced reactions on naturally abundant mononuclidic praseodymium target in the 44-79 MeV incident energy range. Measured data have been interpreted comparing with previous measurements and theoretical prediction of nuclear reaction model code \\textsc{PACE4}. About 5% and 14% of the theoretical cross sections have been measured for $^{149}$Tb and $^{150}$Tb, respectively. The new cross sections of $^{149}$Tb complement those measured earlier by $\\alpha$-spectrometry. Cross sections of $^{151}$Tb are comparable to the theory. Cumulative cross section of $^{149}$Gd sheds light on the nuclear reaction mechanism. In addition, a discussion has been made to show the feasibility of producing $^{149}$Tb in $p$- and $\\alpha$-induced reactions on gadolinium isotopes.

Moumita Maiti

2011-09-29T23:59:59.000Z

359

Crystallization Behavior, Nanostructure and Magnetic Properties of Melt-spun (Nd,Pr,Dy)2(Fe,Co,Mo)14B/-Fe Nanocomposite Magnets  

E-Print Network [OSTI]

behavior, phase evolution, nanostructure, exchange coupling and hard magnetic properties of melt-spun Nd2 extensive attention for the development of novel permanent magnets with high magnetic performance [1, exchange coupling and magnetic properties of the nanocomposites. In the present work, the crystallization

Garmestani, Hamid

360

Neutron scattering study of charge-ordering in R1/3Sr2/3FeO3 (R=La, Pr, Nd, Sm, and Y)  

SciTech Connect (OSTI)

The complicated physical phenomena in complex transition-metal oxides (TMO), such as high Tc superconductivity, colossal magnetoresistivity, metal-insulator transitions, etc., have long been the focus of intense inquiry and debate in condensed matter science, since they are related to strong electronic correlations and cannot be explained within the 'standard model' of solid state physics. These novel functionalities of the correlated electron systems have a wide range of potential for applications in industry, such as information storage, energy transportation, and so on. The charge-ordering (CO) transition is very common in TMO and there is a specific CO transition temperature, TCO. Above TCO, the charge is not ordered, which means that the electrons in a compound are itinerant and the positions of the electrons are not fixed. Below TCO, the charge is ordered, which means that the electrons are localized and the positions of the electrons are settled. Hence, the electrical conductivity of a material is changed at TCO and this transition is classified as metal-insulator transition. Usually the CO with commensurate hole doping in TMO is thought to play an important role in various cases, including the superconducting cuprates, where the spin/charge stripe formation competes with superconducting states, colossal magnetoresistive manganites, where CO competes with ferromagnetic metallic state stabilized by an external magnetic field, layered nickelates, where CO takes the form of the small polaron lattices, and layered manganites, where CO could be bothered by the correlated dynamics of spins and charges. Therefore understanding the causes and implications of CO phenomena is significantly important.

Ma, Jie

2010-05-16T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Transient electronic structure of the photoinduced phase of Pr0.7Ca0.3MnO3 probed with soft x-ray pulses  

E-Print Network [OSTI]

22607, Germany Advanced Photon Source, Argonne NationalLaboratory, Argonne, Illinois, 60439 USA 5 Correlatedthe Advanced Photon Source at Argonne Na- tional Laboratory.

Rini, M.

2010-01-01T23:59:59.000Z

362

D.R. Mason, X. Yi, M.A. Kirk and S.L. Dudarev CCFE-PR(14)05  

E-Print Network [OSTI]

material for the divertor of a fusion power plant [2, 3]. The advantages of tungsten as a divertor material Carlo simulations of evolution of cascades only if elastic interaction between the loops is taken are its high thermal conductivity, close to that of copper, the low sputtering yield, and the rapid decay

363

DNA Vaccination Can Break Immunological Tolerance to PrP in Wild-Type Mice and Attenuates Prion Disease after Intracerebral Challenge  

Science Journals Connector (OSTI)

...Xiang, R., H. N. Lode, T. H. Chao, J. M. Ruehlmann, C. S. Dolman, F. Rodriguez, J. L. Whitton, W. W. Overwijk, N. P. Restifo, and R. A. Reisfeld. 2000. An autologous oral DNA vaccine protects against murine melanoma. Proc...

Natalia Fernandez-Borges; Alejandro Brun; J. Lindsay Whitton; Beatriz Parra; Fayna Diaz-San Segundo; Francisco J. Salguero; Juan M. Torres; Fernando Rodriguez

2006-10-15T23:59:59.000Z

364

ch3probs Page 1 of 9 http://www.jbpub.com/fox/supplementalproblems/ch3pr.htm 11/18/2003  

E-Print Network [OSTI]

broken, one C-C and 3.5 O=O; while 6 O-H and 4 C=O of carbon dioxide are formed. The heat of combustion

Walba, David

365

Last updated, 1/12 O:\\3-2\\Inst Checklists `10\\Inter American University of PR Page 1 of 2  

E-Print Network [OSTI]

, Landscape Architecture, Music, Theatre Arts ALL PNGE, MNG E, and ENENG require an ethics elective Health & Behavioral Science Elective (GS) 3 e.g. Anthropology, Human Development, Political Science, Psychology Aerospace Engineering E E Electrical Engineering ENENG Energy Engineering B E Biological Engineering E SC

Yener, Aylin

366

PePr: a peak-calling prioritization pipeline to identify consistent or differential peaks from replicated ChIP-Seq data  

Science Journals Connector (OSTI)

......and one histone modification dataset (H3K27 tri-methylation...among samples. 2 METHODS 2.1 Datasets 2.1.1 ATF4 data ATF4 data...GA-binding protein (GABP), nuclear respiratory factor 1 (NRF1...ChIP-Seq data. Details of the datasets are provided in Supplementary......

Yanxiao Zhang; Yu-Hsuan Lin; Timothy D. Johnson; Laura S. Rozek; Maureen A. Sartor

2014-09-15T23:59:59.000Z

367

PROGRAMA DE PS-GRADUAO EM BIOENERGIA Campus Universitrio -Av. Colombo, 5790 -Bloco C-67 sala 002 -CEP 87020-900 Maring -PR  

E-Print Network [OSTI]

PROGRAMA DE P?S-GRADUA??O EM BIOENERGIA Campus Universitário - Av. Colombo, 5790 - Bloco C-67-Graduação em Bioenergia ­ Associação em Rede, no uso de suas atribuições estatutárias e regimentais Ingresso em 2014, do Programa de Pós-graduação em Bioenergia, resolve TORNAR P?BLICA A alteração da redação

Paraná, Universidade Federal do

368

Travessa Alfredo Bufren, 140 -3 Andar Bairro Centro -CEP 80.020-240 -Curitiba PR Telefones: (041) 3310-2601 / 3310-2831 FAX: (041) 3310-2607  

E-Print Network [OSTI]

Cortes de Lima Maurício Rodrigo Pilch Nathalia Ferreira Camargo Nathalia Isadori Pucha Batista Rafaela Santos Lista de Espera Anielli Santiago Carla Zafalon Gouveia Cassiana Peres Iago França Lopes Jéssica Carolina Dipp Silva Luis Antonio Bortolli Jr Mariana Ferreira Kienast Marina Kessler Gonçalves Rodrigo D

Paraná, Universidade Federal do

369

M.R. Gilbert, S.L. Dudarev, S. Zheng, L.W. Packer, and J.-Ch. Sublet CCFE-PR(12)02  

E-Print Network [OSTI]

and hydrogen, which cause swelling and embrittlement of materials. This paper investigates, using both neutron, gas production, and helium embrittlement in materials under neutron irradiation. #12;Enquiries about production, and helium embrittlement in materials under neutron irradiation. M.R. Gilbert, S.L. Dudarev, S

370

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f1(1285) IG (JPC ) = 0+(1 + +)  

E-Print Network [OSTI]

8.95 - p + - n 1278 ± 2 140 ARMSTRONG 89 OMEG 300 p p K K p p 1278 ± 2 ARMSTRONG 89G OMEG 85 + p ± 2 420 REEVES 86 SPEC 6.6 p p K K X 1285 ± 2 CHUNG 85 SPEC 8 - p N K K 1279 ± 2 604 ARMSTRONG 84 p p p 2(+ -) 1282 ± 4 ARMSTRONG 93C E760 p p 0 6 1270 ± 6 ±10 ARMSTRONG 92C OMEG 300 p p p p

371

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) K1(1650) I(JP) = 1  

E-Print Network [OSTI]

. · · · 1840 ARMSTRONG 83 OMEG - 18.5 K- p 3K p 1800 DAUM 81C CNTR - 63 K- p K- 2p K1(1650) WIDTHK1 FRAME 86 NP B276 667 D. Frame et al. (GLAS) ARMSTRONG 83 NP B221 1 T.A. Armstrong et al. (BARI, BIRM

372

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) K2(2250) I(JP) = 1  

E-Print Network [OSTI]

AVERAGE2247±17 OUR AVERAGE 2200±40 1 ARMSTRONG 83C OMEG - 18 K- p p X 2235±50 1 BAUBILLIER 81 HBC - 8 K ARMSTRONG 83C OMEG - 18 K- p p X 210±30 2 CLELAND 81 SPEC ± 50 K+ p p X · · · We do not use the following et al. Translated from YAF 66 860. ARMSTRONG 83C NP B227 365 T.A. Armstrong et al. (BARI, BIRM, CERN

373

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f2(1565) IG (JPC ) = 0+(2 + +)  

E-Print Network [OSTI]

30 ,0 1502± 9 ADAMO 93 OBLX np + + - 1488±10 7 ARMSTRONG 93C E760 pp 0 6 1508±10 7 ARMSTRONG 93D E760 pp 30 6 1525±10 7 ARMSTRONG 93D E760 pp 0 0 6 1504 8 WEIDENAUER 93 ASTE 0.0 pN 3- 2+ 1540 OBLX np + + - 148± 27 17 ARMSTRONG 93C E760 pp 0 6 103± 15 17 ARMSTRONG 93D E760 pp 30 6 111± 10

374

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f1(1420) IG (JPC ) = 0+(1 + +)  

E-Print Network [OSTI]

GAM4 100 - p 0 0 n 1430 ± 4 2 ARMSTRONG 92E OMEG 85,300 + p, p p + p , p p (K K ) 1462 ±20 3 ARMSTRONG 89 OMEG 300 p p K K p p 1425 ± 2 1520 ARMSTRONG 84 OMEG 85 + p, p p (+ ,p)(K K )p 1420 BITYUKOV ARMSTRONG 84, ARMSTRONG 89. 3 From fit to the K(892)K 1 + + partial wave. 4 Mass error increased to account

375

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) K3(2320) I(JP) = 1  

E-Print Network [OSTI]

ARMSTRONG 83C OMEG - 18 K- p p X 2320±30 1 CLELAND 81 SPEC ± 50 K+ p p X 1 JP = 3+ from moments analysis 150±30150±30150±30150±30 2 ARMSTRONG 83C OMEG - 18 K- p p X · · · We do not use the following data(2320) REFERENCESK3(2320) REFERENCESK3(2320) REFERENCESK3(2320) REFERENCES ARMSTRONG 83C NP B227 365 T.A. Armstrong

376

FACULTY OF ENGINEERING AND THE BUILT ENVIRONMENT DEAN: PROFESSOR BM LACQUET PrEng BSc(Hon)(Elect) MIng(Elect) DIng (RAU) FSAAE  

E-Print Network [OSTI]

-Chemical Engineering AYLWARD, Lara Anne CHAFA, Phillip Mushayahama DINGILE, Similo GREWAN, Symone JAMES, Nikita Liz Matlhogonolo Simon MUNILAL, Suneshnee NDLOVU, Mpendulo Comfort Mike ARMSTRONG, Philip CLAY, James William DE

Wagner, Stephan

377

Characterization and control of non-stoichiometry in Pr?.?Ce?.?O?-[d?e?l?t?a?] thin films : correlation with SOFC electrode performance  

E-Print Network [OSTI]

While the properties of functional oxide thin films often depend strongly on oxygen nonstoichiometry (6), there have been few means available for its measurement and control in a reliable and in-situ fashion. In this work, ...

Chen, Di, Ph. D. Massachusetts Institute of Technology

2014-01-01T23:59:59.000Z

378

ENGINEERING & SCIENCE S pr i ng/Su m m E r 20112 If you're sitting on a bench in New York  

E-Print Network [OSTI]

ocean currents circulate in a a plume just to the west of the warm water. In our case, this dumps­induced cool- ing depends on heating air over warm ocean water. Since the warm currents along both the pacific an explanation for these chillier winters. The culprit? Warm water. "Warm ocean waters off a continent's eastern

379

NSF -OLPA -PR 03-84: MICROBE FROM DEPTHS TAKES LIFE TO HOTTEST KNOWN LIMIT Congressional Affairs | Newsroom | Speeches | Priority Areas | What's Cool | Publications | Partners |  

E-Print Network [OSTI]

, or 212 F. Strain 121, however, comes from water at the ocean bottom, from a surreal deep-sea realm. Their NSF project may also yield clues to the formation of important ore deposits, the remediation of toxic contaminants, and more efficient recovery from petroleum reserves. On a standard stovetop, water boils at 100 C

Lovley, Derek

380

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f0(2100) IG (JPC ) = 0+(0 + +)  

E-Print Network [OSTI]

/ + - + - 2122 HASAN 94 RVUE pp 1 Includes the data of ANISOVICH 00B indicating to exotic decay pattern. 2± 14 80k 4 UMAN 06 E835 5.2 p p 0 203 BUGG 95 J/ + - + - 273 HASAN 94 RVUE pp 3 Includes 95 PL B353 378 D.V. Bugg et al. (LOQM, PNPI, WASH) HASAN 94 PL B334 215 A. Hasan, D.V. Bugg (LOQM

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) f0(2200) IG (JPC ) = 0+(0 + +)  

E-Print Network [OSTI]

for averages, fits, limits, etc. · · · 2122 HASAN 94 RVUE pp 2321 HASAN 94 RVUE pp 1 First solution, PWA for averages, fits, limits, etc. · · · 273 HASAN 94 RVUE pp 223 HASAN 94 RVUE pp 3 First solution, PWA. Translated from YAF 68 998. HASAN 94 PL B334 215 A. Hasan, D.V. Bugg (LOQM) BARU 89 ZPHY C42 505 S.E. Baru et

382

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) 3(1990) IG (JPC ) = 1+(3 --)  

E-Print Network [OSTI]

, limits, etc. · · · 1982±14 1 ANISOVICH 02 SPEC 0.6­1.9 p p 0, 0, + - 2007 HASAN 94 RVUE p p 1 From HASAN 94 RVUE p p 2 From the combined analysis of ANISOVICH 00J, ANISOVICH 01D, ANISOVICH 01E.V. Anisovich et al. ANISOVICH 00J PL B491 47 A.V. Anisovich et al. HASAN 94 PL B334 215 A. Hasan, D.V. Bugg

383

Principais reas Temticas de Aes de Extenso estabelecidas pelo Frum Nacional de Pr-Reitores de Extenso das Instituies Pblicas de  

E-Print Network [OSTI]

Internacional na área de Educação. Meio Ambiente Preservação e Sustentabilidade do Meio Ambiente; Meio ambiente e desenvolvimento sustentável; Aspectos de meio ambiente e sustentabilidade do Desenvolvimento

Carvalho, João Luiz

384

Syntheses, Structure, Magnetism, and Optical Properties of the Interlanthanide Sulfides delta-Ln2-xLuxS3 (Ln = Ce, Pr, Nd)  

E-Print Network [OSTI]

Syntheses, Structure, Magnetism, and Optical Properties ofstructure determination, magnetism, and optical propertiesSusceptibility Measurements. Magnetism data were measured on

Jin, Geng Bang

2008-01-01T23:59:59.000Z

385

Syntheses, Structure, Magnetism, and Optical Properties of the Partial Ordered Quaternary Interlanthanide Sulfides PrLnYb2S6 (Ln = Tb, Dy)  

E-Print Network [OSTI]

Syntheses, Structure, Magnetism, and Optical Properties ofSusceptibility Measurements. Magnetism data were measured on

Jin, Geng Bang

2008-01-01T23:59:59.000Z

386

Degradation of trichloroethylene by Pseudomonas cepacia G4 and the constitutive mutant strain G4 5223 PR1 in aquifer microcosms.  

Science Journals Connector (OSTI)

...carcinogenic properties (9). Remediation of ground- water aquifers containing TCE...H. 1990. Inefficient remediation of ground-water pollution. Science 250...situ biorestoration as a ground water remediation technique. Ground Water...

M L Krumme; K N Timmis; D F Dwyer

1993-08-01T23:59:59.000Z

387

Efstratios Kokkalis1,4 PR Hoskins2, GA Corner3, PA Stonebridge4, A Melzer1 JG Houston4,5  

E-Print Network [OSTI]

and Medical School, Dundee #12;Spiral laminar flow (SLF) has been observed in healthy large and medium size arteries. The heart is twisted on its axis. The aortic arch is curved, twisted and taped. SLF has been

Greenaway, Alan

388

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) hc(1P) IG (JPC ) = ??(1 + -)  

E-Print Network [OSTI]

.4 ±0.6 ±0.4 168 ± 40 2 ROSNER 05 CLEO (2S) 0 c 3527 ±8 42 ANTONIAZZI 94 E705 300 ±, p Li J/0 X 3526

389

TREM2 in neurodegeneration: evidence for association of the p.R47H variant with frontotemporal dementia and Parkinsons disease  

E-Print Network [OSTI]

Dennis W Dickson 1 , Rosa Rademakers 1* and Owen A Ross 1Genet 2000, 25:357361. Rademakers R, Baker M, Nicholson AM,

2013-01-01T23:59:59.000Z

390

Abstract PR12: Nuclear HSET, a predictor for metastasis, disease relapse, and poor survival, is a racial disparity biomarker in triple-negative breast cancer patients  

Science Journals Connector (OSTI)

...end-directed kinesin that has recently been implicated in carcinogenesis. HSET overexpression predicts lung cancer metastasis to the brain, and HSET is upregulated in triple-negative (TN) breast cancer that most commonly occurs in African American (AA) patients...

Angela Ogden; Gabriela Oprea-Ilies; Padmashree CG Rida; Dana Nickleach; Yuan Liu; Guilherme Cantuaria; Ritu Aneja

2014-11-01T23:59:59.000Z

391

Glass-like recovery of antiferromagnetic spin ordering in a photo-excited manganite Pr0.7Ca0.3MnO3  

E-Print Network [OSTI]

Supercooled liquids and the glass transition. Nature 410, [in molecular and electronic glasses. Rep. Prog. Phys. 59,disorder-induced spin glass state and nanometer scale

Zhou, S.Y.

2014-01-01T23:59:59.000Z

392

Electronic Self-Organization in the Single-Layer Manganite Pr1xCa1xMnO4 F. Ye,1,* Songxue Chi,2  

E-Print Network [OSTI]

,6,7 and Pengcheng Dai2,1 1 Neutron Scattering Science Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee

Tennessee, University of

393

Data:12a99515-0eda-4991-8ebe-b838e14266e0 | Open Energy Information  

Open Energy Info (EERE)

15-0eda-4991-8ebe-b838e14266e0 15-0eda-4991-8ebe-b838e14266e0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Columbus Southern Power Co Effective date: 2012/03/09 End date if known: Rate name: Residential Storage Water Heating Energy Charge Sector: Residential Description: Storage Water Heating Provision: Availability of this provision is limited to those customers served under this provision as of December 31,2000.If the customer installs a Company approved storage water heating system which consumes electrical energy only during off-peak hours as specified by the Company and stores hot water for use during on-peak hours, the following shall apply: (a) For minimum capacity of 80 gallons, the last 300 KWH of use in any month shall be billed at the storage water heating energy charge. (Schedule Code 016)

394

Data:D12a4ee9-489c-4929-96b2-6324a0b8e925 | Open Energy Information  

Open Energy Info (EERE)

ee9-489c-4929-96b2-6324a0b8e925 ee9-489c-4929-96b2-6324a0b8e925 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Raton Public Service Company Effective date: End date if known: Rate name: Security Lights 3- Prompt Payment Discount Sector: Lighting Description: Security lights are available to all (except as noted) residential, commercial and industrial customers served by the Raton Public Service Company for outside lighting purposes at the voltage and phase of the company's distribution system. RPS owns fixture and pole, power is furnished by customer. RPS furnishes parts & service.

395

Data:65a49a12-a982-4cf5-8447-6f7ea00191e7 | Open Energy Information  

Open Energy Info (EERE)

a982-4cf5-8447-6f7ea00191e7 a982-4cf5-8447-6f7ea00191e7 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Anoka, Minnesota (Utility Company) Effective date: 2012/04/01 End date if known: Rate name: Parallel Generation Rate Time of Day Purchase Rate Industrial Sector: Industrial Description: Less than 40KW Source or reference: Rate Binder Kelly 3 ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:

396

Data:6e12a440-93b5-4896-a479-0a2a32a05d2a | Open Energy Information  

Open Energy Info (EERE)

2a440-93b5-4896-a479-0a2a32a05d2a 2a440-93b5-4896-a479-0a2a32a05d2a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Intermountain Rural Elec Assn Effective date: End date if known: 2013/02/01 Rate name: Residential Time of Use (A-TOU) Sector: Residential Description: Residential Time of Use rate. Assumes all adjustments are included. Source or reference: Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

397

Data:12a72f65-3385-4f7c-ab20-1355dd6f6a6b | Open Energy Information  

Open Energy Info (EERE)

-3385-4f7c-ab20-1355dd6f6a6b -3385-4f7c-ab20-1355dd6f6a6b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tri-County Elec Member Corp Effective date: 2008/10/01 End date if known: Rate name: Outdoor Lighting HPS Underground Flood 400 W Sector: Lighting Description: Assuming Existing Pole Source or reference: http://www.tri-countyemc.com/skins/userfiles/file/Outdoor_lighting_1_2_3.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service

398

Data:0b12a8f0-ce39-41bc-b6cf-16606647c57c | Open Energy Information  

Open Energy Info (EERE)

a8f0-ce39-41bc-b6cf-16606647c57c a8f0-ce39-41bc-b6cf-16606647c57c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cuba City, Wisconsin (Utility Company) Effective date: 2009/10/14 End date if known: Rate name: Gs-1 General Service Three Phase Sector: Commercial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0765 per kilowatt-hour.

399

Data:F4d71c12-a075-4e42-ab03-ab9047022664 | Open Energy Information  

Open Energy Info (EERE)

a075-4e42-ab03-ab9047022664 a075-4e42-ab03-ab9047022664 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Borough of Kutztown, Pennsylvania (Utility Company) Effective date: End date if known: Rate name: INSTITIONAL SERVICE RATE120000 Sector: Commercial Description: Source or reference: http://www.kutztownboro.org/kutztown/uploads/ElectricRatesJanuary2012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

400

Data:B12a96b8-e5dc-4002-a47e-f82fe67c5828 | Open Energy Information  

Open Energy Info (EERE)

b8-e5dc-4002-a47e-f82fe67c5828 b8-e5dc-4002-a47e-f82fe67c5828 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mille Lacs Energy Cooperative Effective date: End date if known: Rate name: General Service Sector: Residential Description: Availability Available for all non-commercial service Source or reference: Rate Binder A Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Data:424a30a1-d12a-4cb7-b0f4-9285e6014872 | Open Energy Information  

Open Energy Info (EERE)

2a-4cb7-b0f4-9285e6014872 2a-4cb7-b0f4-9285e6014872 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Kit Carson Electric Coop, Inc Effective date: 2011/09/22 End date if known: Rate name: Market Based Rate Schedule Sector: Industrial Description: Available to all consumers within the Utility's service area who have entered into a contract, with a term of at least one year, for demand of 1,000 kW or more. Service shall be supplied through a point of delivery and measured through primary metering. Source or reference: www.kitcarson.com Source Parent: Comments Applicability Demand (kW)

402

Data:12a1bed7-432b-4810-83de-351ba5b1d371 | Open Energy Information  

Open Energy Info (EERE)

-432b-4810-83de-351ba5b1d371 -432b-4810-83de-351ba5b1d371 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tipton Municipal Electric Util Effective date: 2004/08/13 End date if known: Rate name: Rate E- Outdoor Lighting Service: 400 Watt Metal Halide Sector: Lighting Description: Add $1.15 per month, if pole installation is required. Source or reference: Rates Binder 1, Illinois State University Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service

403

Data:175de12a-c7bb-4312-8cd7-5013d702e8e6 | Open Energy Information  

Open Energy Info (EERE)

2a-c7bb-4312-8cd7-5013d702e8e6 2a-c7bb-4312-8cd7-5013d702e8e6 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Shelby, Ohio (Utility Company) Effective date: End date if known: Rate name: Schedule B- Three Phase Sector: Description: Delivery Voltages: $0.15/kVA Source or reference: http://www.amlegal.com/nxt/gateway.dll/Ohio/shelby_oh/parttenstreetsutilitiesandpublicservices/titlefour-utilities/chapter1050electricity?f=templates$fn=default.htm$3.0$vid=amlegal:shelby_oh$anc=JD_1050.02 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh)

404

Data:7f77674c-c12a-4eca-85a1-474a5732a091 | Open Energy Information  

Open Energy Info (EERE)

Southeastern Power Admin Effective date: 20140516 End date if known: Rate name: Wholesale Power Rate Schedule NC-1-B Sector: Commercial Description: Availability: This rate...

405

Rough order of magnitude cost estimate for immobilization of 50MT of plutonium using new faciliites at the Savannah River site: alternative 12A  

SciTech Connect (OSTI)

The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 50 metric tons of plutonium using ceramic in a new facility at Savannah River Site (SRS).

DiSabatino, A., LLNL

1998-06-01T23:59:59.000Z

406

ZPR-3 Assembly 12 : A cylindrical assembly of highly enriched uranium, depleted uranium and graphite with an average {sup 235}U enrichment of 21 atom %.  

SciTech Connect (OSTI)

Over a period of 30 years, more than a hundred Zero Power Reactor (ZPR) critical assemblies were constructed at Argonne National Laboratory. The ZPR facilities, ZPR-3, ZPR-6, ZPR-9 and ZPPR, were all fast critical assembly facilities. The ZPR critical assemblies were constructed to support fast reactor development, but data from some of these assemblies are also well suited for nuclear data validation and to form the basis for criticality safety benchmarks. A number of the Argonne ZPR/ZPPR critical assemblies have been evaluated as ICSBEP and IRPhEP benchmarks. Of the three classes of ZPR assemblies, engineering mockups, engineering benchmarks and physics benchmarks, the last group tends to be most useful for criticality safety. Because physics benchmarks were designed to test fast reactor physics data and methods, they were as simple as possible in geometry and composition. The principal fissile species was {sup 235}U or {sup 239}Pu. Fuel enrichments ranged from 9% to 95%. Often there were only one or two main core diluent materials, such as aluminum, graphite, iron, sodium or stainless steel. The cores were reflected (and insulated from room return effects) by one or two layers of materials such as depleted uranium, lead or stainless steel. Despite their more complex nature, a small number of assemblies from the other two classes would make useful criticality safety benchmarks because they have features related to criticality safety issues, such as reflection by soil-like material. ZPR-3 Assembly 12 (ZPR-3/12) was designed as a fast reactor physics benchmark experiment with an average core {sup 235}U enrichment of approximately 21 at.%. Approximately 68.9% of the total fissions in this assembly occur above 100 keV, approximately 31.1% occur below 100 keV, and essentially none below 0.625 eV - thus the classification as a 'fast' assembly. This assembly is Fast Reactor Benchmark No. 9 in the Cross Section Evaluation Working Group (CSEWG) Benchmark Specifications and has historically been used as a data validation benchmark assembly. Loading of ZPR-3 Assembly 12 began in late Jan. 1958, and the Assembly 12 program ended in Feb. 1958. The core consisted of highly enriched uranium (HEU) plates, depleted uranium plates and graphite plates loaded into stainless steel drawers which were inserted into the central square stainless steel tubes of a 31 x 31 matrix on a split table machine. The core unit cell consisted of two columns of 0.125 in.-wide (3.175 mm) HEU plates, seven columns of 0.125 in.-wide depleted uranium plates and seven columns of 0.125 in.-wide graphite plates. The length of each column was 9 in. (228.6 mm) in each half of the core. The graphite plates were included to produce a softer neutron spectrum that would be more characteristic of a large power reactor. The axial blanket consisted of 12 in. (304.8 mm) of depleted uranium behind the core. The thickness of the radial blanket was approximately 12 in. and the length of the radial blanket in each half of the matrix was 21 in. (533.4 mm). The assembly geometry approximated a right circular cylinder as closely as the square matrix tubes allowed. According to the logbook and loading records for ZPR-3/12, the reference critical configuration was loading 10 which was critical on Feb. 5, 1958. The subsequent loadings were very similar but less clean for criticality because there were modifications made to accommodate reactor physics measurements other than criticality. Accordingly, ZPR-3/12 loading 10 was selected as the only configuration for this benchmark. As documented below, it was determined to be acceptable as a criticality safety benchmark experiment. An accurate transformation to a simplified model is needed to make any ZPR assembly a practical criticality-safety benchmark. There is simply too much geometric detail in an exact (as-built) model of a ZPR assembly, even a clean core such as ZPR-3/12 loading 10. The transformation must reduce the detail to a practical level without masking any of the important features of the critical experiment. And it must d

Lell, R. M.; McKnight, R. D.; Perel, R. L.; Wagschal, J. J.; Nuclear Engineering Division; Racah Inst. of Physics

2010-09-30T23:59:59.000Z

407

Data:Da12a36f-ae00-4cb4-a9dd-ed19ceba5550 | Open Energy Information  

Open Energy Info (EERE)

reference: http:www.xcelenergy.comstaticfilesxeRegulatoryRegulatory%20PDFsratesMIMieSection4.pdf Source Parent: http:www.xcelenergy.comAboutUsRates&Regulations...

408

CMP 12A, Exam 1, 10/24/2003 Name: Login: 1 This is a 60 minute, CLOSED notes, books, etc. exam.  

E-Print Network [OSTI]

if anything is not clear. WORK INDIVIDUALLY. CHEATERS WILL BE REALLY SORRY. Strategy: Scan the entire exam side1, side2, side3; boolean vs12, vs13, vs21, vs23, vs31, vs32; vs12 = (side1 > side2); vs13 = (side1 > side3); vs21 = (side2 > side1); vs23 = (side2 > side3); vs31 = (side3 > side1); vs32 = (side3 > side2

Pang, Alex

409

Data:E4cc5a03-1850-4ec9-b817-5d679a29f12a | Open Energy Information  

Open Energy Info (EERE)

Medium General Service Sector: Commercial Description: Min. 11 kW - Max. 25 kW, Transformer Max. 50 kVA (MGS) Motors 10 HP (single phase), 50 HP (three phase) Additional kVA...

410

Synthesis of 2'-O-Methoxyethyl-Guanosine Using a Novel Silicon-Based Protecting Group  

E-Print Network [OSTI]

using MDPSCl2 O HO HO OH N NHN N O NH2 N NHN N O NH2OO O OH Si Si iPr iPr iPr iPr O HO HO OH N N N N N N N N OO O OH Si Si iPr iPr iPr iPr NH2NH2 79% 91% O HO HO OH N NN N N NN N OO O OH Si Si iPr iPr iPr iPr NH2NH2 82% NH2 NH2 O HO HO OH OO O OH Si Si iPr iPr iPr iPr 87% N N O NH2 N N O NH2 O HO HO OH

Theodorakis, Emmanuel

411

Catalytic Asymmetric Fluorination Through an Anionic Phase Transfer Strategy  

E-Print Network [OSTI]

. Reaction Platform and Optimization: Fluorocyclization O O P O O- Na+ iPr iPriPr iPr iPriPr TRIP O O P O OH C8H17 C8H17 iPr iPriPr iPr iPriPr catalyst 1 O NH O 5 mol % catalyst 1.25 equiv. Selectfluor 1

Toste, Dean

412

Regulation of motility, the cell cycle, and magnetosome formation in Magnetospirillum magneticum AMB-1  

E-Print Network [OSTI]

r epair enzyme hypot het ical pr ot ein Nif Q pr ot ein f erhypot het ical pr ot ein Nif X pr ot ein nit r ogenasexU-like pr ot ein put at ive nif Z pr ot ein hypot het ical

Greene, Shannon Elizabeth

2012-01-01T23:59:59.000Z

413

Probl`emes de non arbitrage, de recouvrement et d'optimisation  

E-Print Network [OSTI]

Christophe Stricker Pour l'obtention du Doctorat en math´ematiques Universit´e de Franche-Comt´e Rapporteurs : Pr. Nizar Touzi, Pr. Bruno Bouchard Jury : Pr. F. Delbaen, Pr Y. Kabanov, Pr. C. Stricker, Pr. C'aurais jamais pu surmonter sans l'aide de mes deux directeurs de th`ese : Christophe Stricker et Youri Kabanov

Paris-Sud XI, Université de

414

PR OT OCOL FOR I NT E R PR E T AT I ON AND USE OF SE NSOR Y T E ST I NG AND ANAL Y T I CAL CHE MI ST R Y R E SUL T S FOR R E -OPE NI NG OI L -I MPACT E D AR E AS  

E-Print Network [OSTI]

Administration (NOAA) has the authority to close and open Federal waters for seafood harvest and operates the Seafood Inspection Program providing the agency seafood safety and quality expertise. After an oil spill has occurred, Federal and State agencies are faced with the issue of determining when the seafood from

415

Proposed Mechanism For Oxidative Heteroarylation Isolation of an Active Au(III) Fluoride  

E-Print Network [OSTI]

. NN Au iPr iPr iPr iPr F Me F + F- - F- B(OH)2 R R Me 2+ Au F N N Au D D F IPr F PhB(OH)2 CDCl3 D D. Chem. Int. Ed. 2010, 49, 598. O O P O O i-Pr i-Pr i-Pr i-Pr i-Pr i-Pr CR1 R1 OH OR1 R1 H R2 R2 R3 R3 R3

Toste, Dean

416

Gold-Catalyzed Intermolecular Oxyarylation A. D. Melhado, W. E. Brenzovich, Jr., A. D. Lackner, F. D. Toste, J. Am. Chem.  

E-Print Network [OSTI]

. 2010, 132, 12859­12861. NN Au iPr iPr iPr iPr F Me F + F- - F- B(OH)2 R R Me 2+ Au F N N Au D D F IPr F. Int. Ed. 2010, 49, 598. O O P O O i-Pr i-Pr i-Pr i-Pr i-Pr i-Pr CR1 R1 OH OR1 R1 H R2 R2 R3 R3 R3 R3 R

Toste, Dean

417

UNIVERSITY OF CALIFORNIA, SAN DIEGO UCSD BERKELEY DAVIS IRVINE LOS ANGELES MERCED RIVERSIDE SAN DIEGO SAN FRANCISCO SANTA BARBARA SANTA CRUZ  

E-Print Network [OSTI]

*** M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R SUMMER SESSION II by Advisors *** M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R SPECIAL SESSION by Advisors *** M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R M=Major MI

Russell, Lynn

418

Robustness of optimal binary filters: analysis and design  

E-Print Network [OSTI]

Page 16 Functions Pr(Y = l~xt) and Pr(Y = l~xs) for 43 observation vectors, calculated for triplex font. 36 17 Functions (x, p, Pr(Y = 1 ~x) for 30 observation vectors, calculated for triplex font. 37 18 Functions Pr(Y = l~xq) and Pr(Y = l... for gothic font. 40 21 Functions (x, p, Pr(Y = 1~x) for 30 observation vectors, calculated for gothic font. 41 22 Functions Pr(Y = 1~x~) and Pr(Y = l~xs) for 43 observation vectors, calculated for sans-serif font. 42 23 Functions (x, p, Pr(Y = 1~x...

Grigoryan, Artyom M

2012-06-07T23:59:59.000Z

419

Development of Gold-Catalyzed Oxidative Alkene Heteroarylation and of Enantioselective Reactions Enabled by Phase Separation  

E-Print Network [OSTI]

found 388.1521. PhthN O(CO)iPr Ph 1.6k. 5-PhthalimidopenteneVivek Rauniyar, Gregory Hamilton, and Ji Lee. iPr N N F ClBF 4 BF 4 iPr O O P O O - Na + iPr Selectfluor insoluble iPr

Lackner, Aaron D.

2013-01-01T23:59:59.000Z

420

catalystRX Chem 115Myers  

E-Print Network [OSTI]

%) MeO2C H3C CH3 CH3 iPr iPr iPr P Buchwald, S.L.; Naber, J.R. Adv. Synth. Catal. 2008, 350, 957-961 N N

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

SOFTWARE STANDARDS IN CHEMISTRY. PROCEEDINGS OF THE CONFERENCE HELD AT UNIVERSITY OF UTAH, JULY 25-27, 1979. NRCC PROCEEDINGS NO. 7  

E-Print Network [OSTI]

SUBROUTINE AA08(NSP,HEADER,LGH,KEY,PR)'# SYSCOM: INTEGERK,NSP,LEN,KEY,LGH,PR CHARACTER: HEADER(l) REAL FMT(2) DATA FIF(PR.LE.OTPRMX) LEN MINO(LGH,IOCHR:) LINE OUTPUTTER AND

Harris, Frank E.

2011-01-01T23:59:59.000Z

422

2011 CLOuDS Campaign | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CLOuDS Campaign (photo credits: NASA Johnson Space Center) View larger image 11 PR 0706 29 View larger image 11 PR 0706 31 View larger image 11 PR 0706 32 View larger image Jsc...

423

UNIVERSITY OF CALIFORNIA, SAN DIEGO UCSD BERKELEY DAVIS IRVINE LOS ANGELES MERCED RIVERSIDE SAN DIEGO SAN FRANCISCO SANTA BARBARA SANTA CRUZ  

E-Print Network [OSTI]

is to be completed by Advisors *** M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R M MI GE E N/R PR R M=Major MI=Minor GE

Russell, Lynn

424

PHYSICAL REVIEW B 88, 104429 (2013) Modification of magnetic anisotropy through 3d-4 f coupling in La0.75Pr0.25Co2P2  

E-Print Network [OSTI]

, alkali-earth, rare-earth, or actinide metal; T = transition metal; and X = nonmetal. In addition silicides and germanides, provided that proper iso- and aliovalent substitutions are made to modify

Haskel, Daniel

425

P Pr ro of fe es ss si io on na al l A Ac ch hi ie ev ve em me en nt ts s JianHua (Joshua) Qian  

E-Print Network [OSTI]

and coordinating the ARCs (NOAA Application Research Centers) regional climate model intercomparison project Regional Climate Downscaling and Prediction Regional climate downscaling is a critical component in providing detailed local information to fulfill IRI's mission in climate risk management. Regional climate

Qian, Jian-Hua "Joshua"

426

Clemson University Preservation master Plan Part Iv: PrEsErvatIon guIdElInEs ChaPtEr sIx FEbruary 2009 JMa, InC. 377  

E-Print Network [OSTI]

Clemson University historic resource plan that should guide preservation project planning. 6.5 Cultural a management approach for the historic core of Clemson University. Historic resource management should provide Landscape Guidelines: The cultural landscape guidelines provide project planning guidance on issues

Duchowski, Andrew T.

427

J Phys. III FYance 7 (1997) 387-404 FEBRUARY 1997, PAGE 387 Pr(diction des v)brations du stator d'une Inachine h r41uctance  

E-Print Network [OSTI]

Reluctance Motor ID-S-S R M.), different causes of vibrations are considered In this kind of machine) PACS.84.50.+d Electric motors PACS.85 70 Ay Magnetic device characterization, design, and modeling PACSfimes Abstract. In order to predict the radial vibration of the stator core of a Doubly Salient Switched

Paris-Sud XI, Université de

428

> >q"v'>"""C'."f'"~"'"">"""">"'>'",>",>,,~,,,:"" The occupationmimbersand natural orbitalsof ~er~ m~del~~i;i~~tr~~:h;'l~c~le;are pr~  

E-Print Network [OSTI]

' , matrix could be directly calculatedjr(aclosed fonnWhi9p."i~f.;valid,tNQl,lgh' ,. order in the electron

Simons, Jack

429

Oceanography December 2008 173 S P E C I A L I S SU E O N COA StA L O C E A N Pr O C E S S E S  

E-Print Network [OSTI]

limestone reef, and car- bonate sands. The slope of the seafloor is 1:30 from the shore to 40-m water depth during installation. On the center beam, from left: the digital camera; a power/Ethernet infrastructure power, 100 Mbps Ethernet, and full-bandwidth video capability to distribution nodes at 10-m and 20-m

Pawlak, Geno

430

Clemson University, School of Agricultural, Forest and Environmental Sciences, Clemson, South Carolina, U.S.A. Zhengzhou Fruit Research Institute, Chinese Academy of Agricultural Sciences, Zhengzhou, P.R. China 450 009  

E-Print Network [OSTI]

Carolina, U.S.A. 29634-0310 ²Zhengzhou Fruit Research Institute, Chinese Academy of Agricultural Sciences, the native home for peach (and nectarine), has a 3000-year cultivation history (Huang et al., 2008 to the growing development of a new fruit production industry in rudimentary, energy-efficient, solar

Duchowski, Andrew T.

431

arXiv:1009.4437v1[cond-mat.supr-con]22Sep2010 Pressure effects in PrT2B2C (T = Co, Ni, Pt): Applied and chemical pressure  

E-Print Network [OSTI]

Ciencias B´asicas, Universidad Ju´arez Aut´onoma de Tabasco. Cunduacan, Tabasco. 86690 A. Postal 24. M

Paris-Sud XI, Université de

432

Measurements of the spectroscopic and energy transfer parameters for Er3+-doped and Er3+, Pr3+-codoped PbOBi2O3Ga2O3 glasses  

Science Journals Connector (OSTI)

Measurements of the absorption and emission spectra and the characteristics of the luminescent decay of the 4I11/2 and 4I13/2 energy...

Coleman, Daniel J; Jackson, Stuart D; Golding, Paul; King, Terence A

2002-01-01T23:59:59.000Z

433

DOE - Office of Legacy Management -- Center for Energy and Environment...  

Office of Legacy Management (LM)

Center for Energy and Environmental Research - PR 02 FUSRAP Considered Sites Site: Center for Energy and Environmental Research (PR.02 ) Designated Name: Alternate Name: Location:...

434

E-Print Network 3.0 - analgesia em neonatologia Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Page: << < 1 2 3 4 5 > >> 1 Pr Frum: 26082011 Frum: 27082011 Auditrio do Hospital Universitrio HU UFSC CURSO PR FRUM -26082011 Summary: ENFERMAGEM EM TERAPIA...

435

Conductor sizes and overcurrent device ratings are critical to the safe, long-term operation of any electrical system, but  

E-Print Network [OSTI]

of this procedure is in Section 690.8(B) of the 2011 National Electrical Code. Historically, most residential and light-commercial electrical wiring has involved indoor wiring at room temperatures--30°C (86°F) or less of any electrical system, but are particularly important in PV systems where the outdoor environment can

Johnson, Eric E.

436

Insulating state of granular superconductors in a strong-coupling regime I. S. Beloborodov,1 Ya. V. Fominov,1,2 A. V. Lopatin,1 and V. M. Vinokur1  

E-Print Network [OSTI]

Insulating state of granular superconductors in a strong-coupling regime I. S. Beloborodov,1 Ya. V-field-induced insulating state in a two-dimensional granular superconductor with relatively strong intergranular coupling the superconductor-insulator transi- tion, and a reentrant drop upon further increase of magnetic field. The magnetic

Fominov, Yakov

437

Data:Adb12a6c-76a5-4ff7-9db1-8e5b113c0667 | Open Energy Information  

Open Energy Info (EERE)

2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northern States Power Co - Wisconsin Effective date: 20120101 End date if known: Rate name:...

438

RCRA Facility investigation report for Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Volume 5, Technical Memorandums 06-09A, 06-10A, and 06-12A: Environmental Restoration Program  

SciTech Connect (OSTI)

This report provides a detailed summary of the activities carried out to sample groundwater at Waste Area Grouping (WAG) 6. The analytical results for samples collected during Phase 1, Activity 2 of the WAG 6 Resource Conservation and Recovery Act Facility Investigation (RFI) are also presented. In addition, analytical results for Phase 1, activity sampling events for which data were not previously reported are included in this TM. A summary of the groundwater sampling activities of WAG 6, to date, are given in the Introduction. The Methodology section describes the sampling procedures and analytical parameters. Six attachments are included. Attachments 1 and 2 provide analytical results for selected RFI groundwater samples and ORNL sampling event. Attachment 3 provides a summary of the contaminants detected in each well sampled for all sampling events conducted at WAG 6. Bechtel National Inc. (BNI)/IT Corporation Contract Laboratory (IT) RFI analytical methods and detection limits are given in Attachment 4. Attachment 5 provides the Oak Ridge National Laboratory (ORNL)/Analytical Chemistry Division (ACD) analytical methods and detection limits and Resource Conservation and Recovery Act (RCRA) quarterly compliance monitoring (1988--1989). Attachment 6 provides ORNL/ACD groundwater analytical methods and detection limits (for the 1990 RCRA semi-annual compliance monitoring).

Not Available

1991-09-01T23:59:59.000Z

439

9/24/12 A cosmic whodunit: the case of the Higgs boson 1/5www.statesman.com/opinion/insight/a-cosmic-whodunit-the-case-of-the-higgs-2465209.html?viewAs...  

E-Print Network [OSTI]

with mass, and why do the media (but only a few scientists) call the Higgs the "God particle"? To understand and blogs around the world. Scientists using two separate and enormous particle accelerators -- the Tevatron

Toback, David

440

Electronic structure and ionicity of actinide oxides from first principles L. Petit,1,2,* A. Svane,1 Z. Szotek,2 W. M. Temmerman,2 and G. M. Stocks3  

E-Print Network [OSTI]

isotopes through irradiation, thus taking part in the fuel cycle and reducing the long-term nuclear-waste, and Cf. In original, "once through" reactors, the highly radioactive waste that was produced re- sulted in very troublesome long-time storage requirements; particularly of Pu. However, it was soon realized

Svane, Axel Torstein

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

3a-Phenyl-2,3,3a,4-tetrahydro-1H-benzo[d]pyrrolo[1,2-a]imidazol-1-one, a potential plant-growth regulator  

Science Journals Connector (OSTI)

Molecules of the title compound are linked into chains by intermolecular C=OH-N hydrogen bonds and the chains are weakly interconnected by - stacking interactions. A comparison of the geometric parameters of the title molecule and several related benzimidazoles and pyrrolidones is presented.

Grinev, V.S.

2013-07-09T23:59:59.000Z

442

Multiplet effects in the electronic structure of light rare-earth metals S. Lebgue,1,2 A. Svane,3 M. I. Katsnelson,4 A. I. Lichtenstein,5 and O. Eriksson1  

E-Print Network [OSTI]

radioactive element promethium is excluded from our study, since experimental information is more scarce. Also

Svane, Axel Torstein

443

Data:3c12a91f-c90f-4e1e-9d1e-7f1372e6b177 | Open Energy Information  

Open Energy Info (EERE)

1f-c90f-4e1e-9d1e-7f1372e6b177 1f-c90f-4e1e-9d1e-7f1372e6b177 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: CenterPoint Energy Effective date: 2013/01/25 End date if known: Rate name: Secondary Service - Greater than 10 kVa, IDR Metered, greater than 2000 kVa (TC-LOS-A) - Muni Discount Rate Sector: Commercial Description: Delivery Service will be single-phase, 60 hertz, at a standard secondary voltage. Delivery Service will be metered using Company's standard watt-hour Meter provided for this type of Delivery Service. Any other metering option(s) will be provided at an additional charge and/or will be provided by a Meter Owner other than the Company pursuant to Applicable Legal Authorities. Where Delivery Service of the type desired is not available at the Point of Delivery, additional charges and special contract arrangements may be required prior to Delivery Service being furnished, pursuant to Section 6.1.2.2, Construction Services, in this Tariff.

444

Rev. Col. Bras. Cir. 2010; 37(1): 052-057 Stieven FilhoStieven FilhoStieven FilhoStieven FilhoStieven Filho  

E-Print Network [OSTI]

Evangélico de Curitiba/Faculdade Evangélica do Paraná, Curitiba, PR, Brasil. 1. Ortopedista do CTEA, Curitiba, PR, Brasil. 2. Engenheiro mecânico da UTFPR, Curitiba, PR, Brasil. 3. Doutor em Engenharia Mecânica pela Universidade Federal de Santa Catarina; orientador de doutorado da UTFPR, Curitiba, PR, Brasil. 4

Hammerton, James

445

Making Workflows Situation Aware An Ontology-driven Framework  

E-Print Network [OSTI]

Mitsch, Wolfgang Gottesheim Franz Hermann Pommer, Birgit Pröll, Werner Retschitzegger, Wieland Schwinger

Hochreiter, Sepp

446

User Profile Integration Made Easy--Model-Driven Extraction and Transformation of Social Network Schemas  

E-Print Network [OSTI]

Schemas Elisabeth Kapsammer, Angelika Kusel, Stefan Mitsch, Birgit Pröll, Werner Retschitzegger, Wieland

Hochreiter, Sepp

447

Towards a Reference Model for Social User Profiles: Concept & Implementation  

E-Print Network [OSTI]

, Stefan Mitsch, Birgit Pr¨oll, Werner Retschitzegger, Wieland Schwinger Johannes Kepler University Linz

Hochreiter, Sepp

448

Design, synthesis and incorporation of fluorescent thiophene-modified nucleoside analogs  

E-Print Network [OSTI]

triethylamine, pyridine, 85%; (iPr 2 N) 2 POCH 2 CH 2 CN,70%. (b) DMTrCl, Et 3 N, pyridine, 83%. (d) iPr 2 NEt, nBu2 SnCl 2 , (iPr 3 SiO)CH 2 Cl, ClCH 2 CH 2 Cl, 30%. (e) iPr

No, Mary Streid

2012-01-01T23:59:59.000Z

449

LISTE DES MEMBRES DU CONSEIL SCIENTIFIQUE PLENIER Secteur Statut Nom Prnom Fonction Affectation  

E-Print Network [OSTI]

A - Professeurs et assimilés Maths/STIC Titulaire TANNE Gérard PR UFR Sciences et Techniques Maths/STIC Titulaire HUISMAN Johannes PR UFR Sciences et Techniques Maths/STIC Titulaire QUINCAMPOIX Marc PR UFR Sciences et Techniques Mer Titulaire LAROCHE Jean PR UFR Sciences et Techniques Mer Titulaire GENTE Pascal Vice

Brest, Université de

450

BoursesVictorHugoUniversitdeFranche-Comt BECAS VCTOR HUGO  

E-Print Network [OSTI]

pessoal - Informations personnelles Apellido Sobrenome Nom Nombre Nome Prénom Sexo Sexo Sexe Nacionalidad

Jeanjean, Louis

451

kotoxizitt der Seltenen Erden Seltene Erden (SE) oder Metalle der Seltenen Erden  

E-Print Network [OSTI]

), Praseodymium (Pr), Ne- odymium (Nd), Promethium (Pm), Samarium (Sm), Europium (Eu), Gadolinium (Gd), Terbium

Wehrli, Bernhard

452

Overstory/understory relationships in old growth Grand fir habitat types of northeast Oregon  

E-Print Network [OSTI]

limber ol Ides I I PIPOIPHD Numbsf ol sitils 182A 21D 85C 140E 32E 158 51E Sdl Type 182A 21D 85C 86C 1828 ID7D 78D Scil Type 85C 1528 Swl Type I 82A ISD 312D 31 3E Scil Type 51E TamaraSyrupcresk conlplex, 0 lo 15 pwcent... limber ol Ides I I PIPOIPHD Numbsf ol sitils 182A 21D 85C 140E 32E 158 51E Sdl Type 182A 21D 85C 86C 1828 ID7D 78D Scil Type 85C 1528 Swl Type I 82A ISD 312D 31 3E Scil Type 51E TamaraSyrupcresk conlplex, 0 lo 15 pwcent...

Schreder, Peter Todd

2012-06-07T23:59:59.000Z

453

SECRETARIA DE ASSISTNCIA ESTUDANTIL Rua Paulo Gama n. 110, Prdio 12105, Ex. Prdio da Filosofia, Anexo 1 da Reitoria  

E-Print Network [OSTI]

_____________________________________________________________________________________________________ Rua Paulo Gama nº. 110, Prédio 12105, Ex. Prédio da Filosofia, Anexo 1 da Reitoria CEP 90040-060 Porto _____________________________________________________________________________________________________ Rua Paulo Gama nº. 110, Prédio 12105, Ex. Prédio da Filosofia, Anexo 1 da Reitoria CEP 90040-060 Porto _____________________________________________________________________________________________________ Rua Paulo Gama nº. 110, Prédio 12105, Ex. Prédio da Filosofia, Anexo 1 da Reitoria CEP 90040-060 Porto

Mendes, Luis Gustavo Doninelli

454

News Releases  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and energy education grants PR 08-14 Trespassers cost ratepayers money, threaten safety and reliability; reward offered PR 07-14 Mainzer taps Gendron, Ehli to lead Power and...

455

Institut National de Recherche en Informatique et Automatique --Universite Paris-Sud 11 Decoupled Approaches to Register and  

E-Print Network [OSTI]

. Pierre BOULET Pr. Jingling XUE Examinateurs : Dr. Fabrice RASTELLO Pr. Sebastian HACK Dr. Florent BOUCHEZ Manoussakis , professeur à l'université Paris-Sud, M. Sebastian Hack, Professeur à l'université de Saarland et

Paris-Sud XI, Université de

456

Plasma Diagnostics and Plasma-Surface Interactions in Inductively Coupled Plasmas  

E-Print Network [OSTI]

193 nm PR does not roughen. However, roughness increasesto either smooth or further roughen features. Plasma-inducedshow 193 nm PR does not roughen with VUV- only exposures. A

Titus, Monica Joy

2010-01-01T23:59:59.000Z

457

E-Print Network 3.0 - atom tranfer radical Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

10, 1993" Abstract: The N-isopropylated hydrazine radical cations from 7 (22t... Bu,iPr) and 9 (22iPr2) are isolable and are the first examples of isolable hydrazine radical...

458

Prfungs-und Studienordnung fr den Bachelorstudiengang Nanoscience  

E-Print Network [OSTI]

Prüfungs- und Studienordnung für den Bachelorstudiengang Nanoscience an der Universität Regensburg Nanoscience an. 2 Die vorliegende Prüfungs- und Studienordnung regelt den Erwerb von Studien- und

Schubart, Christoph

459

Prion protein in health and disease  

E-Print Network [OSTI]

The prion protein (PrP) is a conserved glycoprotein tethered to cell membranes by a glycosylphosphatidylinositol anchor. In mammals, PrP is expressed in many tissues, most abundantly in brain, heart, and muscle. Importantly, ...

Steele, Andrew D., Ph. D. Massachusetts Institute of Technology

2008-01-01T23:59:59.000Z

460

Evaluation of a WRF dynamical downscaling simulation over California  

E-Print Network [OSTI]

long-term precipitation climatology from WRF, CCSM3, NARR,? Pr Fig. 2 Annual Pr climatology from WRF, CCSM3, and NARRresults shown here are climatologies and thus dont account

Caldwell, Peter; Chin, Hung-Neng S.; Bader, David C.; Bala, Govindasamy

2009-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

EMSL - W-band pulsed EPR spectrometer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

mechanism of electrocatalysis facilitated by Ni(PiPr2NPh2)22+ is analyzed using linear free energy relationships recently established for the Ni(PR2NR&039;2)22+ family. We...

462

EMSL - Nuclei acid structure  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

mechanism of electrocatalysis facilitated by Ni(PiPr2NPh2)22+ is analyzed using linear free energy relationships recently established for the Ni(PR2NR&039;2)22+ family. We...

463

Nuclei acid structure | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

mechanism of electrocatalysis facilitated by Ni(PiPr2NPh2)22+ is analyzed using linear free energy relationships recently established for the Ni(PR2NR'2)22+ family. We thank...

464

metabolomics | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

mechanism of electrocatalysis facilitated by Ni(PiPr2NPh2)22+ is analyzed using linear free energy relationships recently established for the Ni(PR2NR'2)22+ family. We thank...

465

Radiation dose in dental radiology  

Science Journals Connector (OSTI)

...The aim of this study was to compare radiation exposure in panoramic radiography (PR), dental CT, and digital volume tomography (DVT) ... at appropriate locations were exposed as in a dental examination. In PR...

M. Cohnen; J. Kemper; O. Mbes; J. Pawelzik; U. Mdder

2002-03-01T23:59:59.000Z

466

Light-powering Escherichia coli with proteorhodopsin  

Science Journals Connector (OSTI)

...depletion experiment, Ed Delong (Massachusetts Institute...Relative power = = 8.3. The solar spectrum ( spectrum sun...equivalent to PR absorption from solar illumination...roughly three times the PR solar power absorption, see section...

Jessica M. Walter; Derek Greenfield; Carlos Bustamante; Jan Liphardt

2007-01-01T23:59:59.000Z

467

E-Print Network 3.0 - aspectos da geologia Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sabaraense Geologia BelmPA Mariana Borges da Fonseca Psicologia CuritibaPR Andr Luiz... PauloSP Francilene Lopes da Silva Cincias Biolgicas Foz do IguauPR Raisssa...

468

R. Meersman et al. (Eds.): OTM Workshops 2005, LNCS 3762, pp. 206 210, 2005. Springer-Verlag Berlin Heidelberg 2005  

E-Print Network [OSTI]

. Pröll, and W. Retschitzegger Johannes Kepler Universität Linz, Altenbergerstrasse 69, A-4040 Linz http

Hochreiter, Sepp

469

Einleitung Ubiquitous-Webanwendungen Anpassung Beispiele The-GUIDE IBM Websphere Transcoding-Publisher Fazit Ende Literatur Seminar: Intelligente Anwendungen im Internet  

E-Print Network [OSTI]

A Comparison of Approaches Autoren: Gerti Kappel, Birgit Pr¨oll, Werner Retschitzegger, Wieland Schwinger 05

Morik, Katharina

470

Synthesis and applications of quinazoline-based fluorescent nucleoside analogues  

E-Print Network [OSTI]

EDC (1.2 eq. ), DMAP (1.2 eq. ), iPr 2 EtN (2.2 eq. ),EDC (1.2 eq. ), DMAP (1.2 eq. ), iPr 2 EtN (2.2 eq. ),Et 3 N, pyridine, 82%. (e) iPr 2 NEt, nBu 2 SnCl 2 , (iPr 3

Xie, Yun

2010-01-01T23:59:59.000Z

471

NMR studies of the conformation of a triazine dendrimer and the synthesis of a platinated triazine dendrimer  

E-Print Network [OSTI]

.5 kcal/mol in aprotic solvent with relative populations of the rotamers as 5(E Et ,E iPr ): 3(Z Et ,E iPr ): 3(E Et ,Z iPr ): 1(Z Et ,Z iPr ) (Figure 2.8). 74,75 According to the atrazine studies, the E,E rotamer is the most downfield and the Z...

Moreno, Karlos Xavier

2009-05-15T23:59:59.000Z

472

Projekte im Fachgebiet Elektronische Mess-und Diagnosetechnik  

E-Print Network [OSTI]

in Modelica. Werkzeuge: Modelica (OpenModelica oder Dymola) Aufgaben: Einarbeitung in den Prüfstand Entwurf

Wichmann, Felix

473

Rua Marqus de So Vicente, 255 Gvea Rio de Janeiro RJ-Brasil 22451-900  

E-Print Network [OSTI]

desafios contemporâneos. O Centro de Biologia Graziela Maciel Barroso, onde as aulas práticas acontecem

474

TESES E DISSERTAES PREMIADAS PROGRAMA DE PS GRADUAO EM ECONOMIA DA PUC-RIO  

E-Print Network [OSTI]

: Pedro Sampaio Malan 2o. lugar, Prêmio BNDES de Economia, 1982. GUSTAVO HENRIQUE BARROSO FRANCO. Reforma

475

Prfungs-und Studienordnung fr den Bachelorstudiengang Nanoscience  

E-Print Network [OSTI]

Prüfungs- und Studienordnung für den Bachelorstudiengang Nanoscience an der Universität Regensburg

Schubart, Christoph

476

French Literature Reading List 16th-century  

E-Print Network [OSTI]

Graffigny. Lettres d'une Péruvienne Montesquieu. Lettres persanes Prévost. Manon Lescaut Voltaire. Romans et

Segraves, Kari A.

477

Height, adiposity and body fat distribution and breast density in young women  

E-Print Network [OSTI]

SF, Chandler DW, Franklin FA, Barton BA, Patterson BH, Taylor PR, Schatzkin A: Diet and sex hormones in boys:

2012-01-01T23:59:59.000Z

478

Physikalisches Institut Klima-und Umweltphysik  

E-Print Network [OSTI]

Arbeitsgruppe des Community Earth System Models. Fortunat Joos ist Präsident des Oeschger Zentrums für

Richner, Heinz

479

_____________________ Diana Knott Martinelli, Ph.D. ___________________ P.I. Reed School of Journalism, 206 Martin Hall, Morgantown, WV 26506-6010  

E-Print Network [OSTI]

previous year's work): best student-run PR firm; best Web site; student Adrienne Gavula awarded President

Mohaghegh, Shahab

480

_____________________ Diana Knott Martinelli, Ph.D. ___________________ P.I. Reed School of Journalism, 206 Martin Hall, Morgantown, WV 26506-6010  

E-Print Network [OSTI]

student-run PR firm; best Web site; student Adrienne Gavula awarded President's Citation Awarded in 2003

Mohaghegh, Shahab

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Mthodes de prvision des dgradations des structures bties en zone d'affaissement minier Methods for buildings damage estimation located in mining subsidence area  

E-Print Network [OSTI]

, dégradations, prévisions, statistique. Abstract : Mines and underground quarries, exploited or abandoned, can

Paris-Sud XI, Université de

482

Flow, Turbulence and Combustion 62: 295333, 1999. 1999 Kluwer Academic Publishers. Printed in the Netherlands.  

E-Print Network [OSTI]

in the Netherlands. 295 Application of PDF Modeling to Swirling and Nonswirling Turbulent Jets P.R. VAN SLOOTEN

483

 

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

protein: predict length 583 protein: predict length 583 ....,....1....,....2....,....3....,....4....,....5....,....6 AA |SNGIEASLLTDPKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGP| PHD | EE EEEEE HHHHHHHHHH EEEEEEEE | Rel |997411335695111464214899747355786232143699827999982898667886| detail: prH-|000000122102433211100000000366787554463100000000000000111111 prE-|001254221100011102346899720000001333321000157999985100110001 prL-|988644556787444575453100168622110112115799831000014898777886 subset: SUB |LLL.....LLLL....L....EEEE.L.HHHHH......LLLL.EEEEEE.LLLLLLLLL| ....,....7....,....8....,....9....,....10...,....11...,....1 AA |IIEDLNAYGDIFGSSVDHAYETVELATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVD| PHD | E HHHH |

484

Max-Planck-Gesellschaft Rede des Prsidenten zur Festversammlung 2011 62. Jahresversammlung der Max-Planck-Gesellschaft  

E-Print Network [OSTI]

Max-Planck-Gesellschaft Rede des Präsidenten zur Festversammlung 2011 1 62. Jahresversammlung der Max-Planck-Gesellschaft Rede des Präsidenten, Prof. Peter Gruss zur Festversammlung der Max #12;Max-Planck-Gesellschaft Rede des Präsidenten zur Festversammlung 2011 2 Wissenschaftler

Falge, Eva

485

04/03/2014 Tutoriel Web of Science 1 Tutoriel Web of Science  

E-Print Network [OSTI]

04/03/2014 Tutoriel Web of Science 1 Tutoriel Web of Science 1. Présentation et accès ............................................................................................................................4 #12;04/03/2014 Tutoriel Web of Science 2 1. Présentation et accès 1.1 Présentation Organisme responsable Institute for Scientific Information (ISI) Plateforme Web of Knowledge (Thomson Reuters

Maume-Deschamps, Véronique

486

Kinetic, Mechanistic, and Spectroscopic Studies of the Mo/Cu Containing CO dehydrogenase of Oligotropha carboxidovorans  

E-Print Network [OSTI]

et. al. where active site models [Tp iPr MoO(OAr)(?-S)Cu(triazacyclononane) (Tp iPr ) = hydrotris(3-isopropylpyrazol-of CO dehydrogenase: [Tp iPr Mo (V) (O)(OAr)(?-S)Cu (I) (Me

Wilcoxen, Jarett Michael

2013-01-01T23:59:59.000Z

487

Marine-derived heterocycles : structural, synthetic and biological investigations  

E-Print Network [OSTI]

3 ]CHCl 3 (4-CH 3 OPh) 3 P, iPr 2 NEt DMF, 80 C SnBu 3 COnuclear Overhauser effect iPr isopropyl PG protecting groupO O TBSO i) 1.23, TiCl 4 , iPr 2 NEt CH 2 Cl 2 , ! 20 C ii)

Skepper, Colin K.

2009-01-01T23:59:59.000Z

488

OBSERVATIONS IN REACTIVITY BETWEEN BH CONTAINING COMPOUNDS AND ORGANOMETALLIC REAGENTS: SYNTHESIS OF BORONIC ACIDS, BORONIC ESTERS, AND MAGNESIUM HYDRIDES  

E-Print Network [OSTI]

aryl bromides and H 2 BN(iPr) 2 Scheme 2.7. Hydroboration oftransfer hydride to BH 2 -N(iPr) 2 Scheme 2.10. Conversionchloride with BH 2 -N(iPr) 2 Scheme 3; Aqueous quench of p-

Clary, Jacob William

2012-01-01T23:59:59.000Z

489

Synthetic studies toward the pladienolide and spirohexenolide natural products  

E-Print Network [OSTI]

R = OBn, 75% OMe N BOMCl, iPr 2 NEt, TBAI, THF, rt OH quant.crystal of n-Bu 4 NI, and iPr 2 NEt (5 ?L, 0.021 mmol) via3 SMe 2 or BH 3 -THF O PyBOP, iPr 2 NEt, MeONHMe*HCl, O O O

Jones, Brian D.

2010-01-01T23:59:59.000Z

490

Gold(I)-Catalyzed Nucleophilic Additions  

E-Print Network [OSTI]

of ?-Aminoallenes. Me Me iPr 2 mol% AuCl 3 OBn CH 2Cl 2 , 23 C NHR H OBn iPr N R entry R = time % yield % drDihydroisoxazole Formation. Me Me iPr OBn H 2 N OBn 5 mol%

LaLonde, Rebecca Lyn K. C.

2010-01-01T23:59:59.000Z

491

The Development and Application of Phosphine-Catalyzed Annulation Reactions: Synthetic Studies on the Total Synthesis of ()-Reserpine and Studies Concerning Torquoselectivity  

E-Print Network [OSTI]

100% H OBn OMe 2. ClCO 2 Me, iPr 2 NEt CH 2 Cl 2 , 0 C H Nmixed double-Michael addition entry substrate iPr O OOH NHTs iPr N Ts 1a yield% (cis:trans) product OMe 2a O O 1a

Barcan, Gregg

2012-01-01T23:59:59.000Z

492

Carborane Anions: As Weakly Coordinating Counterions and Coordinating Ligands for Catalyst Design  

E-Print Network [OSTI]

phosphine anion, iPr 2 P(CB 11 Cl 11 ) - .Upon coordinationSpecifically, we targeted iPr 2 P(CB 11 Cl 11 ) ? Li + (2),the dianionic intermediate with iPr 2 PCl afforded 2 in 98 %

Wright, James Henry

2013-01-01T23:59:59.000Z

493

Thermodynamics and Enzymatic Polymerization of Artificial Metallo-Nucleic Acids AND Investigation of Duplex Formation between GAN and RNA  

E-Print Network [OSTI]

C rt (92%). (c) DMTrCl, pyridine, rt (69%). (d) (iPr) 2 NP(Cl)OEtCN, (iPr) 2 NEt, CH 2 Cl 2 , rt (71%). Scheme 1. 7N,N-diisopropylehylamine ((iPr) 2 NEt) and 2-cyanoehtyl-N,N-

Kim, Eun Kyong

2011-01-01T23:59:59.000Z

494

Synthesis of Small Molecule Candidate Insulin Mimics by the Claisen Rearrangement  

E-Print Network [OSTI]

growth factor receptor iPr Isopropyl IR Insulin receptor IRR = Bu 78 R = allyl 79 R = iPr DIPEA, toluene rt, Ar O O N RR = Me 109 R = Bu 110 R = iPr Scheme 2.34 Sonogashira-indole

Nalbandian, Jenifer N.

2013-01-01T23:59:59.000Z

495

Alkyl nitrate (C 1 -C 3 ) depth profiles in the tropical Pacific Ocean  

E-Print Network [OSTI]

concentrations with a [ iPr]/[Et] ratio of 0.10.0. Noat all depths with an [iPr]/[Et] ratio of 0.2 0.0. Thiswith ethyl nitrate with an [iPr]/[Et] ratio of 0.2 0.0.

Dahl, E. E; Yvon-Lewis, S. A; Saltzman, E. S

2007-01-01T23:59:59.000Z

496

ARTIGO INTERNET PLUX vence Prmio "Biggest Innovation" em concurso  

E-Print Network [OSTI]

concorreram aos prémios "Biggest Innovation", "Greatest Social Value" e "Potential for Biggest Social ImpactNewsSearch ARTIGO INTERNET PLUX vence Prémio "Biggest Innovation" em concurso internacional in http://www.cienciapt.net Data: 2010-8-16 Link: http://www.cienciapt.net/pt/in ... PLUX vence Prémio "Biggest Innovation" em

Instituto de Sistemas e Robotica

497

Das Prfzentrum Carsten Lampe, Daniel Eggert,  

E-Print Network [OSTI]

Kalibrierlaboratorien" · Qualitätswesen analog den Anforderungen der ISO 9001 z.B. Sensorkalibriersystem / Dokumentation Prüfinstitut (durch DGWK, heute DIN CERTCO) · Seit 2003 ISO/IEC 17025 akkreditiert · Seit 2003 Prüfungen und;4 Was verlangt die Akkreditierung? ISO IEC 17025 ,,Allgemeine Anforderungen an die Kompetenz von Prüf- und

498

A positive solution to Hilbert's 10th problem  

E-Print Network [OSTI]

Polynome codes and code evaluation; arithmetical theory frames; $\\mu$-recursive race for decision; decision correctness; decision termination; correct termination in theory $T = PR$ of Primitive Recursion; comparison with the negative result of Matiyasevich; positive solution in p.r. non-infinite-descent theory $\\pi R=PR+(\\pi).$

Michael Pfender

2014-06-02T23:59:59.000Z

499

High-dimensional semiparametric bigraphical models  

Science Journals Connector (OSTI)

......where c is any positive scalar, so we can let diag(V U) = (1, . . . , 1). Moreover, pr(X | U, V, f ) = pr(X | c2U, V, cf ) = pr(X | U, c2V, cf ). We then set V11 = 1. These two conditions together imply that diag(V ) = (1......

Yang Ning; Han Liu

2013-09-01T23:59:59.000Z

500

FREIEN HANSESTADT BREMEN 2011 Nr. 83Ausgegeben am 2. August 2011  

E-Print Network [OSTI]

Fachspezifische Prüfungsordnung für den Bachelorstudiengang ,,Chemie" (Vollfach) der Universität Bremen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . S . 903 Fachspezifische Prüfungsordnung für das Fach ,,Chemie" im Zwei-Fächer-Bachelorstudium der . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . S . 925 903 Fachspezifische Prüfungsordnung für den Bachelorstudiengang ,,Chemie" (Vollfach) der

Hoffmeister, Thomas S.