Powered by Deep Web Technologies
Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:60bbd68c-86f7-400b-a280-156c7c97fedd | Open Energy Information  

Open Energy Info (EERE)

bbd68c-86f7-400b-a280-156c7c97fedd bbd68c-86f7-400b-a280-156c7c97fedd No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Baudette, Minnesota (Utility Company) Effective date: 2011/04/20 End date if known: Rate name: Rate 6 Off Peak Commercial Sector: Commercial Description: Off-peak rates are for winter months only: Sept 21 - June 20. The other time will be calculated using Rate 2 Commercial rates. The monthly fixed charge is a weighted average between the two rates. Source or reference: Rate Binder Kelly 3 ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW):


Data:187059d1-e799-4c86-ab62-1c22cf3c8013 | Open Energy Information  

Open Energy Info (EERE)

e799-4c86-ab62-1c22cf3c8013 e799-4c86-ab62-1c22cf3c8013 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Borough of Kutztown, Pennsylvania (Utility Company) Effective date: 2012/01/01 End date if known: Rate name: INSTITIONAL SERVICE RATE 120000 NON ELECTRIC Sector: Commercial Description: Source or reference: http://www.kutztownboro.org/kutztown/uploads/ElectricRatesJanuary2012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service


Data:1eb97ce4-35bb-42e2-8844-13792c86e87e | Open Energy Information  

Open Energy Info (EERE)

5bb-42e2-8844-13792c86e87e 5bb-42e2-8844-13792c86e87e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Slash Pine Elec Member Corp Effective date: End date if known: Rate name: Rate LMS-8 Load Management Service Sector: Commercial Description: Rate LMS-8 Load Management Service Source or reference: ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous


Data:47bbc30f-0c8f-4f5c-86ee-4b4837e55251 | Open Energy Information  

Open Energy Info (EERE)

bbc30f-0c8f-4f5c-86ee-4b4837e55251 bbc30f-0c8f-4f5c-86ee-4b4837e55251 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Central Hudson Gas & Elec Corp Effective date: 2012/07/01 End date if known: Rate name: DS-S 150 Watt ( Victorian Gaslight) Sector: Lighting Description: Source or reference: http://www.centralhudson.com/rates/index.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:9a107c86-df21-451c-8139-2d87c087c6bb | Open Energy Information  

Open Energy Info (EERE)

7c86-df21-451c-8139-2d87c087c6bb 7c86-df21-451c-8139-2d87c087c6bb No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Edmond, Oklahoma (Utility Company) Effective date: 2009/09/30 End date if known: Rate name: Additional charges-Extension of Secondary Circuit and Wood Pole-45 Sector: Commercial Description: Source or reference: http://edmondok.com/DocumentCenter/Home/View/442 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:


Data:2ec69015-6947-44ff-b569-2d9c86b06cea | Open Energy Information  

Open Energy Info (EERE)

5-6947-44ff-b569-2d9c86b06cea 5-6947-44ff-b569-2d9c86b06cea No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Durant, Mississippi (Utility Company) Effective date: 2013/06/21 End date if known: Rate name: AL 11 Sector: Lighting Description: Source or reference: ISU Archive Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous 1 2 3 Next >> Seasonal/Monthly Demand Charge Structures


Data:857e7087-0a3c-4c86-bdd7-3392a7e93b29 | Open Energy Information  

Open Energy Info (EERE)

87-0a3c-4c86-bdd7-3392a7e93b29 87-0a3c-4c86-bdd7-3392a7e93b29 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nolin Rural Electric Coop Corp Effective date: 2011/06/01 End date if known: Rate name: Street Lighting: Ornamental Service Overhead 400 Watt HPS Sector: Lighting Description: Source or reference: www.nolinrecc.com Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>


Data:5747662d-5252-44b9-aad9-9c86e0bdf20b | Open Energy Information  

Open Energy Info (EERE)

62d-5252-44b9-aad9-9c86e0bdf20b 62d-5252-44b9-aad9-9c86e0bdf20b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Pardeeville, Wisconsin (Utility Company) Effective date: 2007/10/10 End date if known: Rate name: Cp-1 Small Power Service Transformer Ownership Discount with Parallel Generation(20kW or less) Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0680 per kilowatt-hour.


Data:3fdb68c2-4238-40c6-9138-dc4c86f670a5 | Open Energy Information  

Open Energy Info (EERE)

fdb68c2-4238-40c6-9138-dc4c86f670a5 fdb68c2-4238-40c6-9138-dc4c86f670a5 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Jackson County Rural E M C Effective date: 2011/10/01 End date if known: Rate name: Purchase Offer "R" Sector: Residential Description: Available to any customer on a first-come, first-served basis with on-site distributed generation capacity of 15 kW or less that is powered by renewable resources (e.g. solar, wind, or low-head hydro) and interconnected with Jackson County REMC (REMC) per specifications. Total participation under this tariff is limited to one-tenth of one percent (0.1%) of REMC's peak load during the preceding twelve-month period.


Data:Dd1e1a9d-dc62-479a-ada5-cd015624c86b | Open Energy Information  

Open Energy Info (EERE)

e1a9d-dc62-479a-ada5-cd015624c86b e1a9d-dc62-479a-ada5-cd015624c86b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northeast Nebraska P P D Effective date: 2013/01/01 End date if known: Rate name: LP2 Large Power Service - Sub-Transmission Substation Sector: Industrial Description: 1.1 This Rate Schedule LP-2 is offered for the entire electrical requirements at a single location of any industrial or manufacturing Customer requiring 5,000 kVa or more of installed transformer capacity, and for which there exists an executed power Purchase Contract between the Customer and the District. Resale of energy taken under this rate schedule by the Customer is not permitted.


Data:8d83505b-002e-406c-86fd-ef5c21cfcc9b | Open Energy Information  

Open Energy Info (EERE)

505b-002e-406c-86fd-ef5c21cfcc9b 505b-002e-406c-86fd-ef5c21cfcc9b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Omaha Public Power District Effective date: 2013/01/01 End date if known: Rate name: 115 RESIDENTIAL CONSERVATION SERVICE Sector: Residential Description: To single-family dwellings, farms including only one residential dwelling, trailers, or to each of the units of flats, apartment houses, or multi-family dwellings, when such units are metered individually in the District's Service Area. A "unit" shall be a trailer, apartment, flat, or unit of a multi-family dwelling, equipped with cooking facilities. The single phase, alternating current, electric service will be supplied at the District's standard voltages of 240 volts or less, for residential uses, when all electric service furnished under this Schedule is measured by one meter. This Rate Schedule includes service for air-conditioning motors not exceeding 7 1/2 horsepower each, other motors not exceeding 3 horsepower each; but excludes X-ray and other appliances producing abnormal voltage fluctuations. Not applicable to shared or resale service.


Data:88e35c86-394c-466b-af95-77ffb7c0166c | Open Energy Information  

Open Energy Info (EERE)

c86-394c-466b-af95-77ffb7c0166c c86-394c-466b-af95-77ffb7c0166c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Carroll Electric Member Corp Effective date: 2012/02/01 End date if known: Rate name: Outdoor Lighting Underground Wiring Wood Pole HPS 1000 W Sector: Lighting Description: *IDC Rider Charges included in Fixed Monthly Charge $275 one time charge for instillation Source or reference: http://www.cemc.com/Files/OL-2%20Outdoor%20Lighting%20final%202012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh):


Data:0ad55bc8-09cd-4c0a-8c50-c86e23acce41 | Open Energy Information  

Open Energy Info (EERE)

bc8-09cd-4c0a-8c50-c86e23acce41 bc8-09cd-4c0a-8c50-c86e23acce41 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Muscoda, Wisconsin (Utility Company) Effective date: 2010/10/26 End date if known: Rate name: Cp-2 Large Power Service with Parallel Generation(20kW or less) Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0844 per kilowatt-hour.


Data:E9473217-04c6-4c86-97e2-a67831261362 | Open Energy Information  

Open Energy Info (EERE)

7-04c6-4c86-97e2-a67831261362 7-04c6-4c86-97e2-a67831261362 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cumberland, Wisconsin (Utility Company) Effective date: 2006/03/15 End date if known: Rate name: Ms-1 Street Lighting Service Overhead 175 W MV w/out pole Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0294per kilowatt-hour.


Data:3275f978-aee6-4b9f-9ed4-e6bad3c86a1d | Open Energy Information  

Open Energy Info (EERE)

aee6-4b9f-9ed4-e6bad3c86a1d aee6-4b9f-9ed4-e6bad3c86a1d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Reedsburg Utility Comm Effective date: 2011/06/01 End date if known: Rate name: Cp-1 TOD Small Power Optional Time-of-Day Service Primary Metering and Transformer Ownership Discount Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0785 per kilowatt-hour.


Data:5280bf35-a79b-4f34-a343-c86d1644d544 | Open Energy Information  

Open Energy Info (EERE)

5-a79b-4f34-a343-c86d1644d544 5-a79b-4f34-a343-c86d1644d544 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cleveland, Ohio (Utility Company) Effective date: End date if known: Rate name: Street Lighting ornamental, 175w mv, 30 ft steel pole Sector: Lighting Description: street lighting,ornamental mercury vapor 175 watt with maximum 75kwh per lamp. Source or reference: http://www.cpp.org/CPP%20RRR%20ORDINANCE%20as%20of%2011-14-06.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months):


Data:451ffc40-8115-466b-a4a4-94f8c86e3c96 | Open Energy Information  

Open Energy Info (EERE)

ffc40-8115-466b-a4a4-94f8c86e3c96 ffc40-8115-466b-a4a4-94f8c86e3c96 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: GreyStone Power Corporation Effective date: 2008/11/01 End date if known: Rate name: Outdoor Lighting Post Top (NLA) MV 100 W Sector: Lighting Description: Additional Charges: Poles and Conductor (a) Overhead Service Length, Facility Rate, Contribution 30 ft. Wood Pole $ 2.25 $ 210 35 ft. Wood Pole $ 2.50 $ 235 40 ft. Wood Pole $ 2.95 $ 275 45 ft. Wood Pole $ 3.30 $ 310 (b) Underground Service Length, Facility Rate, Contribution 30 ft. Wood Pole $ 2.25 $ 210 30& ft. Wood Pole $ 6.25 $ 395


Data:A3ab2293-5178-4cb7-95a0-e1e1b4625c86 | Open Energy Information  

Open Energy Info (EERE)

293-5178-4cb7-95a0-e1e1b4625c86 293-5178-4cb7-95a0-e1e1b4625c86 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Princeton, Wisconsin (Utility Company) Effective date: 2006/09/14 End date if known: Rate name: Ms-1 Street Lighting Service Ornamental 150 W HPS Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0524 per kilowatt-hour.


Data:5aad73b9-a25e-4c86-8322-006a2c4c7784 | Open Energy Information  

Open Energy Info (EERE)

aad73b9-a25e-4c86-8322-006a2c4c7784 aad73b9-a25e-4c86-8322-006a2c4c7784 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Richland, Washington (Utility Company) Effective date: 2013/01/01 End date if known: Rate name: Schedule 70: Security Lighting Area Lighting - Metered 1,000 Watt Mercury Vapor Sector: Lighting Description: A. Availability: In all territory served by the City's electric utility. B. Applicability: To all property owners or long-term leasees of property. C. Contract Provisions: The rates in this schedule apply to facilities consisting of overhead construction with mast arms and luminaries mounted on wood poles with lumen output as shown. Lighting facilities supplied under this schedule shall remain the property of the City, and shall be supplied only pursuant to a contract with the customer, the term of which shall be a period of not less than three (3) years. Pole Rental: When an individual wood pole is required on a new installation, the following monthly charges apply: 40 feet or less $ 1.00 Over 40 feet $ 1.00 plus $0.05 per foot Additional charge will be made for lamps installed seventy-five (75) feet or more above the ground.


Data:5e8c1abd-cc61-477c-86f8-9f1c78a58de7 | Open Energy Information  

Open Energy Info (EERE)

abd-cc61-477c-86f8-9f1c78a58de7 abd-cc61-477c-86f8-9f1c78a58de7 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Murray, Kentucky (Utility Company) Effective date: 2013/06/01 End date if known: Rate name: Outdoor Lighting- 100W High Pressure Sodium Sector: Lighting Description: Available for service to street and park lighting systems, traffic signal systems, athletic field lighting installations, and outdoor lighting for individual customers. Source or reference: http://www2.murray-ky.net/outdoor_lighting_with_murray_electric_system.html Source Parent: Comments Applicability Demand (kW)

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:D5eb05e7-4c21-410a-96e7-a1b816c39c86 | Open Energy Information  

Open Energy Info (EERE)

5e7-4c21-410a-96e7-a1b816c39c86 5e7-4c21-410a-96e7-a1b816c39c86 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Salt River Electric Coop Corp Effective date: 2011/06/01 End date if known: Rate name: Underground mercury vapor w/o pole 175 Watts Sector: Lighting Description: Source or reference: www.srelectric.com Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous


Data:15fb8a46-8c86-4227-99f4-8f4ac7c61c7f | Open Energy Information  

Open Energy Info (EERE)

fb8a46-8c86-4227-99f4-8f4ac7c61c7f fb8a46-8c86-4227-99f4-8f4ac7c61c7f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Lincoln Electric System Effective date: End date if known: Rate name: Large Light and Power Off-Peak Seasonal Daily Primary Sector: Description: Excess kVA Source or reference: http://www.les.com/your_business/rate_schedules_llp.aspx Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:6a8c9c86-b007-441c-b9b5-4f805bd2dfd5 | Open Energy Information  

Open Energy Info (EERE)

c9c86-b007-441c-b9b5-4f805bd2dfd5 c9c86-b007-441c-b9b5-4f805bd2dfd5 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: Customer Generation Under Buy/Sell Concept - Transmission Lines Sector: Industrial Description: To any customer whose requirements are taken at a point or points determined by the District under a contract of standard form, where the customer's total monthly demand load exceeds 20,000 kilowatts and the customer takes delivery on the secondary side of a District Substation on the customer's property. (Not applicable to resale, standby or auxiliary service.)


Data:616a6045-2c28-4fe7-95a3-4a1ab14c86c0 | Open Energy Information  

Open Energy Info (EERE)

045-2c28-4fe7-95a3-4a1ab14c86c0 045-2c28-4fe7-95a3-4a1ab14c86c0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Cornhusker Public Power Dist Effective date: 2012/01/01 End date if known: Rate name: Irrigation and Grain-Drying Service I-4 (17, 18)- Seven Control Days - With Capacitor Sector: Residential Description: Source or reference: Illinois State University Binder #10 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:


Data:D12e81a4-0c87-4c86-a8a8-49b5d633be10 | Open Energy Information  

Open Energy Info (EERE)

e81a4-0c87-4c86-a8a8-49b5d633be10 e81a4-0c87-4c86-a8a8-49b5d633be10 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of River Falls, Wisconsin (Utility Company) Effective date: 2008/04/11 End date if known: Rate name: Ms-2 Area Lighting Service 150 Watt High Pressure Sodium Sector: Lighting Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0662 per kilowatt-hour.



NLE Websites -- All DOE Office Websites (Extended Search)

BNL BNL - SM D Page 1/5 BEPC-II Quadrupole and Dipole Double Layer Coil Patterns 5 0 0 0 1 0 0 2 0 0 3 0 0 4 0 0 6 0 0 7 0 0 Z (mm) 300 200 100 0 θ (deg.) 5 0 0 0 1 0 0 2 0 0 3 0 0 4 0 0 Z (mm) 300 200 100 0 θ (deg.) -100 100 -50 50 0 -100 100 -50 50 0 X (mm) Y (mm) SCQ SCB ( HDC) SCQ L coi l = 496 m m L m ag = 400 m m L coi l = 674 m m L m ag = 400 m m Page 2 /5 Z IP (distance from IP, mm) R (mm) 95 6 0 0 1 6 0 0 8 0 0 1 0 0 0 1 2 0 0 1 4 0 0 90 100 105 110 115 120 AS1 AS3 AS2 SCQ SCB (HDC) VDC SKQ Name Layers Conductor SCQ 8 7 strand cable SCB 2 7 strand cable (HDC) VDC 2 1 strand wire SKQ 2 1 strand wire AS1 6 MRI wire AS2 2 MRI wire AS2 6 MRI wire BEPC-II Coil Layout Schematic Page 3 /5 Page 4 /5 Z (cm) R (cm) BES- I I IDet ect or 0 20 60 100 140 180 220 260 300 -1.6 -1.2 -0.8 -0.4 0.0 0.4 0.8 B z on axis (T) AS1 AS2 AS3 (AS2 overlaps SCQ) Z (cm) BES-III Detector and the Three Part Anti-Solenoid Compensation Scheme A S 1-3 are connected i n seri es, but A S 2 & A S 3 have tri m s. Page 5 /5 B, G (T), (T/m) R in , R out



E-Print Network (OSTI)

Open channel flow of water has been used in aquaculture production for many years. Distribution canals, raceways and drainage ditches are some examples. Since the beginning of civilization man has been interested in flow in open channels. Attempts to record the levels on the Nile River date

J. David Bankston; Fred Eugene Baker; Sextus Julius; Frontinus Water




NLE Websites -- All DOE Office Websites (Extended Search)

BN BN L - SM D Page 1/11 Page 2 /11 B, G (T), (T/m) R in , R out (mm) From IP (mm) Coil Length (mm) Magnetic Length (mm) AS1 - 95.1~105.9 630~933 303 - AS2 - 115.4~119.0 1035~1381 346 - AS3 - 95.1~105.9 1474~1590 116 - SCQ 18.744 95.1~108.1 961~1457 496 400 SCB (HCD) 0.543 0.056 108.5~111.8 633~1307 674 400 VCD 0.059 111.9~113.5 904~1514 610 380 SKQ 0.937 113.6~115.2 954~1464 510 400 Operating Current (A) * ** ** 460 495 (50) 24 45 BEPC-II Magnets 12-May-03 * **AS2 and AS3 are in series with AS1 but can have their own independent trim currents. BEPC-II Superconducting IR Magnet Coil Parameter Summary Z (cm) R (cm) 1 / 2 BES- I I IDet ect orw i t h Ant i - Sol enoi d BEPC-II Anti-Solenoid Design Parameter Summary I m ai n = 1120 A N AS1 = 732 t ur ns N AS2 = 260 t ur ns N AS3 = 280 t ur ns N Tot = 1272 t ur ns L Tot = 78 m H Page 3 /11 Page 4 /11 AS1R AS2R AS3R AS1L AS2L AS3L Left Side Right Side A S 1R A S 2R A S 3R I M ai n ∆I I2R ∆I I3R A S 1L A S 2L A


AOCS Official Method Ca 12a-02  

Science Conference Proceedings (OSTI)

Colorimetric Determination of Phosphorus Content in Fats and Oils AOCS Official Method Ca 12a-02 Methods Methods and Analyses Analytical Chemistry Methods Downloads Methods Downloads DEFINITION The test portion


Participants si n an Pr c r  

E-Print Network (OSTI)

r r r r; as r s #12; arrati str ct r r r r #12; arrati c nt nt r r r #12; in r a a rati n str ct r #12; a rati n

Golbeck, Jennifer


acs_PR_pr-2011-00851y 1..12  

NLE Websites -- All DOE Office Websites (Extended Search)

pr200851y pr200851y | J. Proteome Res. XXXX, XXX, 000-000 ARTICLE pubs.acs.org/jpr Defining the Boundaries and Characterizing the Landscape of Functional Genome Expression in Vascular Tissues of Populus using Shotgun Proteomics Paul Abraham, †,‡,§ Rachel Adams, †,‡,§ Richard J. Giannone, ‡ Udaya Kalluri, || Priya Ranjan, || Brian Erickson, ‡ Manesh Shah, ‡ Gerald A. Tuskan, || and Robert L. Hettich* ,‡ ) Biosciences Division and ‡ Chemical Sciences Division at Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831, United States § Graduate School of Genome Science and Technology, University of Tennessee, Knoxville, Tennessee 37830, United States b S Supporting Information ' INTRODUCTION The advent of high-throughput DNA sequencing has revolutio- nized the assembly of high-quality genomes for prokaryotes and eukaryotes such as plants and humans. 1 The


On the locality of the Pr\\"ufer code  

E-Print Network (OSTI)

The Pr\\"ufer code is a bijection between trees on the vertex set $[n]$ and strings on the set $[n]$ of length $n-2$ (Pr\\"ufer strings of order $n$). In this paper we examine the `locality' properties of the Pr\\"ufer code, i.e. the effect of changing an element of the Pr\\"ufer string on the structure of the corresponding tree. Our measure for the distance between two trees $T,T^*$ is $\\Delta(T,T^*)=n-1-| E(T)\\cap E(T^*)|$. We randomly mutate the $\\mu$th element of the Pr\\"ufer string of the tree $T$, changing it to the tree $T^*$, and we asymptotically estimate the probability that this results in a change of $\\ell$ edges, i.e. $P(\\Delta=\\ell | \\mu).$ We find that P(\\Delta=\\ell | \\mu)$ is on the order of $ n^{-1/3+o(1)}$ for any integer $\\ell>1,$ and that $P(\\Delta=1 | \\mu)=(1-\\mu/n)^2+o(1).$ This result implies that the probability of a `perfect' mutation in the Pr\\"ufer code (one for which $\\Delta(T,T^*)=1$) is $1/3.$

Lennon, Craig



acs_PR_pr-2011-00536j 1..13  

NLE Websites -- All DOE Office Websites (Extended Search)

1, 1, 2011 r 2011 American Chemical Society 5302 dx.doi.org/10.1021/pr200536j | J. Proteome Res. 2011, 10, 5302-5314 ARTICLE pubs.acs.org/jpr Label-free Quantitative Proteomics for the Extremely Thermophilic Bacterium Caldicellulosiruptor obsidiansis Reveal Distinct Abundance Patterns upon Growth on Cellobiose, Crystalline Cellulose, and Switchgrass Adriane Lochner, †,‡,§,|| Richard J. Giannone, ‡,||,^ Martin Keller, †,‡ Garabed Antranikian, § David E. Graham,* ,†,# and Robert L. Hettich* ,‡,^ † Biosciences Division; ^ Chemical Sciences Division; ‡ BioEnergy Science Center at Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831, United States § Technical Microbiology, Hamburg University of Technology, Kasernenstrasse 12, D-21073 Hamburg, Germany # Department of Microbiology, University of Tennessee, Knoxville, Tennessee 37996,


Underwater Explosive Shock Consolidation of Nanocomposite Pr2Fe14B/-Fe Magnetic Powders  

E-Print Network (OSTI)

PR O O FS Underwater Explosive Shock Consolidation of Nanocomposite Pr2Fe14B/-Fe Magnetic Powders; Accepted January 6, 2005) Keywords: explosive compaction, underwater shock wave, nanocomposites, magnetic

Liu, J. Ping


Glass Forming Ability in Pr-(Cu, Ni)-Al Alloys  

E-Print Network (OSTI)

Glass forming ability (GFA) in the Pr-rich Pr-(Cu, Ni)-Al alloys at or near the eutectic points was systematically studied. It was found that the GFA in the pseudo-ternary alloys of Pr-(Cu, Ni)-Al is higher than that of ...

Zhang, Yong



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

PR-10084713 PR-10084713 Title: Purchase of BH Control Valve Assembly Description: Vendor shall supply and deliver one 16-inch, 600# Control Valve Assembly to the Big Hill SPR site. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following: (1) The proposed action fits within a class of actions that is listed in Appendix A or B of Subpart D; (2) There are no extraordinary circumstances related to the proposal that may affect the


Transition Probabilities And Chiral Symmetry In 134Pr  

SciTech Connect

Lifetime measurements in 134Pr were performed by means of the Recoil distance Doppler-shift and Doppler-shift attenuation methods using the multidetector array EUROBALL, in conjunction with the inner BGO ball. The derived B(E2) transition strengths within the two bands candidates for chiral partners behave differently with increasing spin while the corresponding B(M1) values have a similar behaviour within the experimental uncertainties.

Tonev, D.; De Angelis, G.; Gadea, A.; Axiotis, M.; Marginean, N.; Martines, T.; Napoli, D.R.; Prete, G.; Behera, B.R.; Rusu, C. [INFN - Laboratori Nazionali di Legnaro, Viale dell Universita 2, 35020 Legnaro, PD (Italy); Petkov, P. [Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Dewald, A.; Pejovic, P.; Fitzler, A.; Moeller, O.; Zell, K.O. [Institut fuer Kernphysik der Universitaet zu Koeln, D-50937 Cologne(Germany); Balabanski, D. [Dipartimento di Fisica, Universita di Camerino, I-62032 Camerino (Italy); Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Bednarczyk, P. [IReS, 23 rue du Loess, BP28 F-67037, Strasbourg (France); Camera, F.; Paleni, A. [Dipartimento di Fisica, Universita di Milano, I-20133 Milan (Italy)] [and others




U.S. Energy Information Administration (EIA) Indexed Site

Gas Reserve Class Gas Reserve Class No 2001 gas reserves 0.1 - 10 MMCF 10.1 - 100 MMCF 100.1 - 1,000 MMCF 1,000.1 - 10,000 MMCF 10,000.1 - 100,000 MMCF > 100,000 MMCF Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas,



U.S. Energy Information Administration (EIA) Indexed Site

Liquids Reserve Class Liquids Reserve Class No 2001 liquids reserves 0.1 - 10 Mbbl 10.1 - 100 Mbbl 100.1 - 1,000 Mbbl 1,000.1 - 10,000 Mbbl 10,000.1 - 100,000 Mbbl Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas, Energy Information Administration pursuant to studies required by



U.S. Energy Information Administration (EIA) Indexed Site

BOE Reserve Class BOE Reserve Class No 2001 reserves 0.1 - 10 MBOE 10.1 - 100 MBOE 100.1 - 1,000 MBOE 1,000.1 - 10,000 MBOE 10,000.1 - 100,000 MBOE > 100,000 MBOE Basin Outline CO Index Map For 2 Powder River Basin Panels WY MT SD NE ND Powder River Basin 1 2 NE Total Total Total Number Liquid Gas BOE of Reserves Reserves Reserves Fields (Mbbl) (MMcf) (Mbbl) Powder River 543 193,456 2,398,604 593,223 Basin 2001 Reserve Summary for All Powder River Basin Fields PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM PR B_WY_C BM The mapped oil and gas field boundary outlines were created by the Reserves and Production Division, Office of Oil and Gas,

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


PR-EDB: Power Reactor Embrittlement Database - Version 3  

Science Conference Proceedings (OSTI)

The aging and degradation of light-water reactor pressure vessels is of particular concern because of their relevance to plant integrity and the magnitude of the expected irradiation embrittlement. The radiation embrittlement of reactor pressure vessel materials depends on many factors, such as neutron fluence, flux, and energy spectrum, irradiation temperature, and preirradiation material history and chemical compositions. These factors must be considered to reliably predict pressure vessel embrittlement and to ensure the safe operation of the reactor. Large amounts of data from surveillance capsules are needed to develop a generally applicable damage prediction model that can be used for industry standards and regulatory guides. Furthermore, the investigations of regulatory issues such as vessel integrity over plant life, vessel failure, and sufficiency of current codes, Standard Review Plans (SRPs), and Guides for license renewal can be greatly expedited by the use of a well-designed computerized database. The Power Reactor Embrittlement Database (PR-EDB) is such a comprehensive collection of data for U.S. designed commercial nuclear reactors. The current version of the PR-EDB lists the test results of 104 heat-affected-zone (HAZ) materials, 115 weld materials, and 141 base materials, including 103 plates, 35 forgings, and 3 correlation monitor materials that were irradiated in 321 capsules from 106 commercial power reactors. The data files are given in dBASE format and can be accessed with any personal computer using the Windows operating system. "User-friendly" utility programs have been written to investigate radiation embrittlement using this database. Utility programs allow the user to retrieve, select and manipulate specific data, display data to the screen or printer, and fit and plot Charpy impact data. The PR-EDB Version 3.0 upgrades Version 2.0. The package was developed based on the Microsoft .NET framework technology and uses Microsoft Access for backend data storage, and Microsoft Excel for plotting graphs. This software package is compatible with Windows (98 or higher) and has been built with a highly versatile user interface. PR-EDB Version 3.0 also contains an "Evaluated Residual File" utility for generating the evaluated processed files used for radiation embrittlement study.

Wang, Jy-An John [ORNL; Subramani, Ranjit [ORNL



diff -ruN oommf12a4pre-20100719/app/mmdisp/scripts ...  

Science Conference Proceedings (OSTI)

diff -ruN oommf12a4pre-20100719/app/mmdisp/scripts/mmdisp.tcl oommf12a4pre-20100719bis/app/mmdisp/scripts/mmdisp.tcl --- oommf12a4pre ...



Dynamic compressive behavior of Pr-Nd alloy at high strain rates and temperatures  

Science Conference Proceedings (OSTI)

Based on compressive tests, static on 810 material test system and dynamic on the first compressive loading in split Hopkinson pressure bar (SHPB) tests for Pr-Nd alloy cylinder specimens at high strain rates and temperatures, this study determined a J-C type [G. R. Johnson and W. H. Cook, in Proceedings of Seventh International Symposium on Ballistics (The Hague, The Netherlands, 1983), pp. 541-547] compressive constitutive equation of Pr-Nd alloy. It was recorded by a high speed camera that the Pr-Nd alloy cylinder specimens fractured during the first compressive loading in SHPB tests at high strain rates and temperatures. From high speed camera images, the critical strains of the dynamic shearing instability for Pr-Nd alloy in SHPB tests were determined, which were consistent with that estimated by using Batra and Wei's dynamic shearing instability criterion [R. C. Batra and Z. G. Wei, Int. J. Impact Eng. 34, 448 (2007)] and the determined compressive constitutive equation of Pr-Nd alloy. The transmitted and reflected pulses of SHPB tests for Pr-Nd alloy cylinder specimens computed with the determined compressive constitutive equation of Pr-Nd alloy and Batra and Wei's dynamic shearing instability criterion could be consistent with the experimental data. The fractured Pr-Nd alloy cylinder specimens of compressive tests were investigated by using 3D supper depth digital microscope and scanning electron microscope.

Wang Huanran; Cai Canyuan; Chen Danian [Mechanics and Materials Science Research Center, Ningbo University, Ningbo, Zhejiang 315211 (China); Ma Dongfang [Mechanics and Materials Science Research Center, Ningbo University, Ningbo, Zhejiang 315211 (China); School of Civil Engineering, Henan Polytechnic University, Jiaozuo, Henan 454000 (China)



Transition Probabilities in {sup 134}Pr: A Test for Chirality in Nuclear Systems  

SciTech Connect

Exited states in {sup 134}Pr were populated in the fusion-evaporation reaction {sup 119}Sn({sup 19}F,4n){sup 134}Pr. Recoil distance Doppler-shift and Doppler-shift attenuation measurements using the Euroball spectrometer, in conjunction with the inner Bismuth Germanate ball and the Cologne plunger, were performed at beam energies of 87 MeV and 83 MeV, respectively. Reduced transition probabilities in {sup 134}Pr are compared to the predictions of the two quasiparticle+triaxial rotor and interacting boson fermion-fermion models. The experimental results do not support the presence of static chirality in {sup 134}Pr underlying the importance of shape fluctuations. Only within a dynamical context the presence of intrinsic chirality in {sup 134}Pr can be supported.

Tonev, D. [Laboratori Nazionali di Legnaro, INFN, I-35020 Legnaro (Italy); Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); De Angelis, G.; Gadea, A.; Marginean, N.; Napoli, D.R.; Prete, G. [Laboratori Nazionali di Legnaro, INFN, I-35020 Legnaro (Italy); Petkov, P. [Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Dewald, A.; Pejovic, P.; Fitzler, A.; Moeller, O.; Zell, K.O. [Institut fuer Kernphysik der Universitaet zu Koeln, D-50937 Cologne (Germany); Brant, S. [Department of Physics, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia); Frauendorf, S. [Department of Physics, University of Notre Dame, Notre Dame, Indiana 46556 (United States); Balabanski, D.L. [Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Dipartimento di Fisica, Universita di Camerino and INFN Perugia, I-62032 Camerino (Italy); Bazzacco, D.; Lenzi, S.; Lunardi, S. [Dipartimento di Fisica, Universita and INFN Sezione di Padova, I-35131 Padova (Italy); Bednarczyk, P.; Curien, D. [Institut de Recherches Subatomiques, Boite Postale 28 F-67037, Strasbourg (France)] (and others)



Comparison of Drop Size Distribution Parameter (D0) and Rain Rate from S-Band Dual-Polarized Ground Radar, TRMM Precipitation Radar (PR), and Combined PRTMI: Two Events from Kwajalein Atoll  

Science Conference Proceedings (OSTI)

The estimation of the drop size distribution parameter [median volume diameter (D0)] and rain rate (R) from the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) as well as from combined PRTRMM Microwave Imager (TMI) algorithms ...

V. N. Bringi; Gwo-Jong Huang; S. Joseph Munchak; Christian D. Kummerow; David A. Marks; David B. Wolff



Appendix B: CArBon dioxide CApture teChnology SheetS Oxygen PrOductiOn  

NLE Websites -- All DOE Office Websites (Extended Search)

Oxygen PrOductiOn B-500 Oxygen PrOductiOn u.S. dePartment Of energy advanced carbOn diOxide caPture r&d PrOgram: technOlOgy uPdate, may 2013 itm Oxygen technOlOgy fOr integratiOn...


Colossal dielectric constant and relaxation behaviors in Pr:SrTiO{sub 3} ceramics  

Science Conference Proceedings (OSTI)

Sr{sub 1-x}Pr{sub x}TiO{sub 3} ceramics (0.00{<=}x{<=}0.03) were prepared by a traditional solid-state reaction method. Two relaxation processes (marked as A and B) of the Sr{sub 0.09}Pr{sub 0.01}TiO{sub 3} ceramics were investigated by analyzing the E{sub a} values obtained from the Arrhenius law. Colossal dielectric constant (CDC) was first obtained in Sr{sub 0.09}Pr{sub 0.01}TiO{sub 3} ceramics, whose permittivity was up to 3000 (1 kHz, room temperature), greater than that of pure SrTiO{sub 3} ceramics and samples with more Pr addition (x=0.02 and 0.03). This CDC behavior was related to the internal barrier layer capacitance mechanism.

Liu Cheng; Liu Peng; Zhou Jianping; Su Lina; Cao Lei [College of Physics and Information Technology, Shaanxi Normal University, Xi'an 710062 (China); He Ying; Zhang Huaiwu [State Key Laboratory of Electronic Thin Film and Intergrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)



Possible Misidentification of Rain Type by TRMM PR over Tibetan Plateau  

Science Conference Proceedings (OSTI)

Rain-type statistics derived from Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) standard product show that some 70% of raining pixels in the central Tibetan Plateau summer are stratiforma clear contradiction to the common ...

Yunfei Fu; Guosheng Liu



Evaluation of Coincident Passive Microwave Rainfall Estimates Using TRMM PR and Ground Measurements as References  

Science Conference Proceedings (OSTI)

This study compares instantaneous rainfall estimates provided by the current generation of retrieval algorithms for passive microwave sensors using retrievals from the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) and merged ...

Xin Lin; Arthur Y. Hou



The use of coreference resolution for understanding manipulation commands for the PR2 Robot  

E-Print Network (OSTI)

Natural language interaction can enable us to interface with robots such as the Personal Robot 2 (PR2), without the need for a special training or equipment. Programming such a robot to follow commands is challenging because ...

Simeonov, Dimitar N



Three New Companies Join the Broadband Forum Board of Directors Proactive PR Online General Europe Three New Companies Join the Broadband Forum Board of Directors Proactive PR Online General North America Three New Companies Join the Broadband Forum Board  

E-Print Network (OSTI)

Three New Companies Join the Broadband Forum Board Statesman (Austin, TX) 03/19/13 of Directors Proactive PR Online General North America

Three New; Companies Join; Broadband Forum Board



Table HC4-12a. Air Conditioning by West Census Region, Million U.S ...  

U.S. Energy Information Administration (EIA)

Table HC4-12a. Air Conditioning by West Census Region, Million U.S. Households, 2001 Air Conditioning Characteristics RSE Column Factor: Total U.S.


12 a ficha de exerccios de Mecanica Geometrica 27 de Maio de 2002  

E-Print Network (OSTI)

12 a ficha de exerc??�cios de Mec??anica Geom??etrica 27 de Maio de 2002 1. Seja (M,#) uma variedade

Natário, José


Spectral Retrieval of Latent Heating Profiles from TRMM PR Data. Part II: Algorithm Improvement and Heating Estimates over Tropical Ocean Regions  

Science Conference Proceedings (OSTI)

The spectral latent heating (SLH) algorithm was developed for the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) in Part I of this study. The method uses PR information [precipitation-top height (PTH), precipitation rates at ...

Shoichi Shige; Yukari N. Takayabu; Wei-Kuo Tao; Chung-Lin Shie



Spectral Retrieval of Latent Heating Profiles from TRMM PR Data. Part IV: Comparisons of Lookup Tables from Two- and Three-Dimensional Cloud-Resolving Model Simulations  

Science Conference Proceedings (OSTI)

The spectral latent heating (SLH) algorithm was developed to estimate latent heating profiles for the Tropical Rainfall Measuring Mission Precipitation Radar (TRMM PR). The method uses TRMM PR information (precipitation-top height, precipitation ...

Shoichi Shige; Yukari N. Takayabu; Satoshi Kida; Wei-Kuo Tao; Xiping Zeng; Chie Yokoyama; Tristan LEcuyer



Fluoride-added Pr-Fe-B die-upset magnets with increased electrical resistivity  

SciTech Connect

This work reports the effect of NdF{sub 3}, DyF{sub 3}, and CaF{sub 2} additions on the electrical resistivity and magnetic properties of Pr-Fe-B hot-pressed and die-upset permanent magnets. Composite magnets were synthesized from ground Pr{sub 14.5}Fe{sub 79.5}B{sub 6} melt-spun ribbons blended with 5 wt % of fluoride fine powders and consolidated by hot pressing at 650 deg. C, followed by die upsetting at 800 deg. C. While CaF{sub 2} is stable at the processing temperatures, the rare earth atoms separate from their fluorides to a certain degree with the assistance of the Pr-rich phase from the magnet matrix. Addition of fluorides increased the resistivity of the hot-pressed specimens by more than 200%. The resistivity of the die-upset specimens measured perpendicularly to the direction of the applied pressure, which is also the direction of magnetization, is, however, only slightly increased compared to the magnet counterparts without the fluoride addition. The intrinsic coercivity of Pr{sub 14.5}Fe{sub 79.5}B{sub 6} die-upset specimens is increased from 14.5 kOe to 15.3, 17.1, and 17.7 kOe for the addition of CaF{sub 2}, DyF{sub 3}, and NdF{sub 3}, respectively, at a slight expense of the residual flux.

Marinescu, M.; Liu, J. F. [Electron Energy Corporation, 924 Links Ave., Landisville, Pennsylvania 17538 (United States); Gabay, A. M.; Hadjipanayis, G. C. [Department of Physics and Astronomy, University of Delaware, Newark, Delaware 19716 (United States)



Very High-Temperature Reactor (VHTR) Proliferation Resistance and Physical Protection (PR&PP)  

SciTech Connect

This report documents the detailed background information that has been compiled to support the preparation of a much shorter white paper on the design features and fuel cycles of Very High-Temperature Reactors (VHTRs), including the proposed Next-Generation Nuclear Plant (NGNP), to identify the important proliferation resistance and physical protection (PR&PP) aspects of the proposed concepts. The shorter white paper derived from the information in this report was prepared for the Department of Energy Office of Nuclear Science and Technology for the Generation IV International Forum (GIF) VHTR Systems Steering Committee (SSC) as input to the GIF Proliferation Resistance and Physical Protection Working Group (PR&PPWG) (http://www.gen-4.org/Technology/horizontal/proliferation.htm). The short white paper was edited by the GIF VHTR SCC to address their concerns and thus may differ from the information presented in this supporting report. The GIF PR&PPWG will use the derived white paper based on this report along with other white papers on the six alternative Generation IV design concepts (http://www.gen-4.org/Technology/systems/index.htm) to employ an evaluation methodology that can be applied and will evolve from the earliest stages of design. This methodology will guide system designers, program policy makers, and external stakeholders in evaluating the response of each system, to determine each system's resistance to proliferation threats and robustness against sabotage and terrorism threats, and thereby guide future international cooperation on ensuring safeguards in the deployment of the Generation IV systems. The format and content of this report is that specified in a template prepared by the GIF PR&PPWG. Other than the level of detail, the key exception to the specified template format is the addition of Appendix C to document the history and status of coated-particle fuel reprocessing technologies, which fuel reprocessing technologies have yet to be deployed commercially and have only been demonstrated in testing at a laboratory scale.

Moses, David Lewis [ORNL



Appendix B: CArBon dioxide CApture teChnology SheetS Oxygen PrOductiOn  

NLE Websites -- All DOE Office Websites (Extended Search)

Oxygen PrOductiOn Oxygen PrOductiOn B-500 Oxygen PrOductiOn u.S. dePartment Of energy advanced carbOn diOxide caPture r&d PrOgram: technOlOgy uPdate, may 2013 itm Oxygen technOlOgy fOr integratiOn in igcc and Other advanced POwer generatiOn SyStemS primary project goals Air Products and Chemicals set out to design and develop an ion transport membrane (ITM) based on ceramics that selectively transport oxygen (O 2 ) ions when operated at high temperature. This high-temperature process may be integrated with advanced power genera- tion processes that require O 2 as a feedstock, such as integrated gasification combined cycle (IGCC) and other clean energy and industrial applications. technical goals * Design, construct, and operate a 0.1-ton/day (TPD) technology development unit


Comparison of Rainfall Profiles in the West African Monsoon as Depicted by TRMM PR and the LMDZ Climate Model  

Science Conference Proceedings (OSTI)

Vertical rainfall profiles obtained with TRMM-PR 2A25 standard products are compared with rain profiles deduced from the Laboratoire de Mtorologie Dynamique second generation global climate model (LMDZ, the Z stands for zoom capability) with ...

Samo Diatta; Frdric Hourdin; Amadou Thierno Gaye; Nicolas Viltard



Shallow and Deep Latent Heating Modes over Tropical Oceans Observed with TRMM PR Spectral Latent Heating Data  

Science Conference Proceedings (OSTI)

Three-dimensional distributions of the apparent heat source (Q1) ? radiative heating (QR) estimated from Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR) utilizing the spectral latent heating (SLH) algorithm are analyzed. Mass-...

Yukari N. Takayabu; Shoichi Shige; Wei-Kuo Tao; Nagio Hirota


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Process hazards analysis (PrHA) program, bridging accident analyses and operational safety  

SciTech Connect

Recently the Final Safety Analysis Report (FSAR) for the Plutonium Facility at Los Alamos National Laboratory, Technical Area 55 (TA-55) was revised and submitted to the US. Department of Energy (DOE). As a part of this effort, over seventy Process Hazards Analyses (PrHAs) were written and/or revised over the six years prior to the FSAR revision. TA-55 is a research, development, and production nuclear facility that primarily supports US. defense and space programs. Nuclear fuels and material research; material recovery, refining and analyses; and the casting, machining and fabrication of plutonium components are some of the activities conducted at TA-35. These operations involve a wide variety of industrial, chemical and nuclear hazards. Operational personnel along with safety analysts work as a team to prepare the PrHA. PrHAs describe the process; identi fy the hazards; and analyze hazards including determining hazard scenarios, their likelihood, and consequences. In addition, the interaction of the process to facility systems, structures and operational specific protective features are part of the PrHA. This information is rolled-up to determine bounding accidents and mitigating systems and structures. Further detailed accident analysis is performed for the bounding accidents and included in the FSAR. The FSAR is part of the Documented Safety Analysis (DSA) that defines the safety envelope for all facility operations in order to protect the worker, the public, and the environment. The DSA is in compliance with the US. Code of Federal Regulations, 10 CFR 830, Nuclear Safety Management and is approved by DOE. The DSA sets forth the bounding conditions necessary for the safe operation for the facility and is essentially a 'license to operate.' Safely of day-to-day operations is based on Hazard Control Plans (HCPs). Hazards are initially identified in the PrI-IA for the specific operation and act as input to the HCP. Specific protective features important to worker safety are incorporated so the worker can readily identify the safety parameters of the their work. System safety tools such as Preliminary Hazard Analysis, What-If Analysis, Hazard and Operability Analysis as well as other techniques as necessary provide the groundwork for both determining bounding conditions for facility safety, operational safety, and day-to-clay worker safety.

Richardson, J. A. (Jeanne A.); McKernan, S. A. (Stuart A.); Vigil, M. J. (Michael J.)



PROJET PR-ET POST-PROCESSEURS POUR NETGEN Ce projet qui s'inscrit dans le domaine des lments finis se prsente en deux parties qui peuvent  

E-Print Network (OSTI)

librairies graphiques à utiliser sont de préférence Qt et opengl, éventuellement tcl/tk. #12;2ème partie

Noé, Laurent


Implementation of the PR&PP methodology: the role of formal expert elicitations  

SciTech Connect

The application of the methodology developed by the GenIV International Forum's (GIF's) Proliferation Resistance and Physical Protection (PR&PP) Working Group is an expert elicitation. Although the framework of the methodology is structured and systematic, it does not by itself constitute or require a formal elicitation. However, formal elicitation can be utilized in the PR&PP context to provide a systematic, credible and transparent qualitative analysis and develop input for quantitative analyses. This section provides an overview of expert elicitations, a discussion of the role formal expert elicitations can play in the PR&PP methodology, an outline of the formal expert elicitation process and a brief practical guide to conducting formal expert elicitations. Expert elicitation is a process utilizing knowledgeable people in cases, for example, when an assessment is needed but physically based data is absent or open to interpretation. More specifically, it can be used to: (1) predict future events; (2) provide estimates on new, rare, complex or poorly understood phenomena; (3) integrate or interpret existing information; or (4) determine what is currently known, how well it is known or what is worth learning in a field. Expert elicitation can be informal or formal. The informal application of expert judgment is frequently used. Although it can produce good results, it often provides demonstrably biased or otherwise flawed answers to problems. This along with the absence of transparency can result in a loss of confidence when experts speak on issues. More formal expert elicitation is a structured process that makes use of people knowledgeable in certain areas to make assessments. The reason for advocating formal use is that the quality and accuracy of expert judgment comes from the completeness of the expert's understanding of the phenomena and the process used to elicit and analyze the data. The use of a more formal process to obtain, lU1derstand and analyze expert judgment has led to an improved acceptance of expert judgment because of the rigor and transparency of the results.

Pilat, Joseph F [Los Alamos National Laboratory




NLE Websites -- All DOE Office Websites (Extended Search)

88952 88952 PR EPRlNT FUNDAMENTAL CONCEPTS OF DIGITAL IMAGE PROCESSING R. E. Twogood I n v i t e d Paper f o r t h e I n t e r n a t i o n a l Symposium and Course on E l e c t r o n i c Imaging i n Medicine San Antonio, Texas March 1983 ; This is a preprint of a paper intended for publication in a journal or proceedings. Since changes may be made before publication. this preprint is made available with the un- derstanding. that it will not be cited or reproduced without the permission of the author. DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsi-


Influence of Alloy Microstructure on Oxide Growth in HCM12A in Supercritical Water Jeremy Bischoff1  

E-Print Network (OSTI)

corrosion resistance. Because of their radiation and stress corrosion cracking resistance, ferritic to oxidation appears to enhance the corrosion resistance of the alloy [2]. In the present study, HCM12A samples on the corrosion resistance but these results are not shown in this article. The oxide layers formed on HCM12A

Motta, Arthur T.


Potentiometric studies on mixed ligand complexes of La (III), Pr (III), and Nd (III) with nitrilotriacetic acid and mercapto acids  

Science Conference Proceedings (OSTI)

An attempt is made to investigate the systems MAL (where M = La (III), Pr (III), or Nd (III), A = NTA, and L = TGA or TMEA) in order to observe the contribution of pi-interaction in the M-S bond.

Tandon, J.P.; Rana, H.S.; Sharma, M.K.



ELSEVIER Journal of Luminescence 65 (1995) 199 209 Determination of oscillator strengths in Pr3 + : YAlO, by Raman  

E-Print Network (OSTI)

substates of the 3H4 ground state and `II2 excited state of Pr3' :YAIO,. The oscillator strengths depend substates of the electronic ground state of those atoms, whose resonance frequencies fall into the range to resolve individual nuclear spin substates of electronic ground or excited states. Due to the high

Suter, Dieter


Data:E6b74c86-7700-4665-9871-9ce5ff669295 | Open Energy Information  

Open Energy Info (EERE)

7700-4665-9871-9ce5ff669295 7700-4665-9871-9ce5ff669295 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Jackson, Tennessee (Utility Company) Effective date: 2012/08/01 End date if known: Rate name: General Service GSA3 Sector: Commercial Description: General Service GSA3. Source or reference: http://www.jaxenergy.com/rates/downloads/ELECTRIC_R.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:


EFTEM and EELS analysis of the oxide layer formed on HCM12A exposed to SCW Jeremy Bischoff  

E-Print Network (OSTI)

and stress corrosion cracking, ferritic­martensitic steels, such as HCM12A, are candidate materials the corrosion resistance of these alloys. ? 2012 Elsevier B.V. All rights reserved. 1. Introduction 1

Motta, Arthur T.


Flaxseed in Human Nutrition, 2nd EditionChapter 12 a-Linolenic Acid and Heart Disease  

Science Conference Proceedings (OSTI)

Flaxseed in Human Nutrition, 2nd Edition Chapter 12 a-Linolenic Acid and Heart Disease Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Press Downloadable


Microstructure and Magnetic Properties of PrMnO{sub 3} Bulk and Thin Film  

Science Conference Proceedings (OSTI)

Perovskite PrMnO{sub 3}(PMO) had been prepared in bulk by solid state reaction and thin films on corning glass, fused silica and MgO (100) glass substrate by pulsed laser deposition technique. SEM micrographs show that grains with size 2{approx}3 {mu}m is observed in bulk PMO while thin films PMO show strongly connected grain structure with particle size that not larger than 100 nm. X-ray diffraction analysis shows that all samples are in single phase with orthorhombic crystal structure. Bulk PMO sample had lattice strain of 0.134% which is the lowest value among others. However, larger lattice strain was observed in thin film samples due to lattice mismatch between film-substrate and caused the MnO{sub 6} to deform. All samples shown paramagnetic or antiferromagnetic behavior, enhancement in magnetization value occurred for all PMO grew as film. We believe that larger lattice strain favor the grain growth of PMO towards more order phase. In summary, formation of structure and microstructure of thin film PMO depends on type of substrate used and it affect the magnetic property.

Lim, K. P.; Halim, S. A.; Chen, S. K.; Ng, S. W.; Wong, J. K.; Gan, H. M. Albert [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor (Malaysia); Woon, H. S. [College of Engineering, Universiti Tenaga Nasional, Jalan IKRAM-UNITEN, 43000 Kajang, Selangor (Malaysia)



Pauli blocking in the low-lying, low-spin states of {sup 141}Pr  

SciTech Connect

The low-lying, low-spin levels of {sup 141}Pr were investigated using (n,n{sup '}{gamma}) techniques. Level energies, branching ratios, and tentative spin assignments for more than 100 states, linked by nearly 300 transitions, were obtained from two angular distributions (E{sub n}=2.0 and 3.0 MeV) and an excitation function measurement (E{sub n}=1.5-3.2 MeV). The application of the Doppler-shift attenuation method led to the determination of lifetimes. The obtained spectroscopic data provide insight into the wave functions of the states observed. A detailed analysis of the [2{sub 1}{sup +} x d{sub 5/2}] and [2{sub 1}{sup +} x g{sub 7/2}] multiplets provides the first quantitative evidence for Pauli blocking in a spherical odd-mass nucleus. The unpaired particle is used to probe the microscopic structure of the first 2{sup +} state of the adjacent core nuclei {sup 140}Ce and {sup 142}Nd.

Scheck, M.; Choudry, S. N.; Elhami, E.; McEllistrem, M. T.; Mukhopadhyay, S.; Orce, J. N. [Dept. of Physics and Astronomy, University of Kentucky, Lexington, Kentucky 40506-0055 (United States); Yates, S. W. [Dept. of Physics and Astronomy, University of Kentucky, Lexington, Kentucky 40506-0055 (United States); Dept. of Chemistry, University of Kentucky, Lexington, Kentucky 40506-0055 (United States)



Eleven new compounds in the RE-Cd-Ge systems (RE=Pr, Nd, Sm, Gd-Yb; Y): Crystal chemistry of the RE{sub 2}CdGe{sub 2} series  

SciTech Connect

A large new family of rare-earth metal-cadmium-germanides RE{sub 2}CdGe{sub 2} (RE=Y, Pr, Nd, Sm, Gd-Yb) has been synthesized and structurally characterized. All eleven structures have been established from single-crystal X-ray diffraction data and have been found to belong to the tetragonal Mo{sub 2}FeB{sub 2} structure type (ordered ternary variant of the U{sub 3}Si{sub 2} structure type-space group P4/mbm (No. 127), Z=2; Pearson symbol tP10). The structural variations among the three series of isostructural RE{sub 2}MgGe{sub 2}, RE{sub 2}InGe{sub 2}, and RE{sub 2}CdGe{sub 2} compounds are discussed, as well as the crystal chemistry changes as a function of the decreasing size of the rare-earth metals (lattice constants a=7.176(2)-7.4589(12) A and c=4.1273(14)-4.4356(13) A). The experimental results have been complemented by tight-binding linear muffin-tin orbital (TB-LMTO) electronic structure calculations. - Graphical abstract: More than 300 compounds have been reported to crystallize with the tetragonal U{sub 3}Si{sub 2} structure type, or the Mo{sub 2}FeB{sub 2} structure type, which is its ordered ternary variant. Among them, there are several large RE{sub 2}CdX{sub 2} classes, where the X-elements are typically late transition metals such as Cu, Ni, Au, Pd, Pt, and Rh. The new RE{sub 2}CdGe{sub 2} phases (RE=Y, Pr, Nd, Sm, Gd-Yb) increase the diversity and represent the first cadmium germanides. Highlights: Black-Right-Pointing-Pointer RE{sub 2}CdGe{sub 2} (RE=Y, Pr, Nd, Sm, Gd-Yb) are new ternary germanides. Black-Right-Pointing-Pointer Their structures can be recognized as a 1:1 intergrowth of CsCl- and AlB{sub 2}-like slabs. Black-Right-Pointing-Pointer The Ge atoms are covalently bound into Ge{sub 2} dumbbells. Black-Right-Pointing-Pointer Almost all RE{sub 2}CdGe{sub 2} phases are the first structurally characterized phases in the respective ternary RE-Cd-Ge systems.

Guo Shengping; Meyers, John J.; Tobash, Paul H. [Department of Chemistry and Biochemistry, University of Delaware, Newark, Delaware 19716 (United States); Bobev, Svilen, E-mail: bobev@udel.edu [Department of Chemistry and Biochemistry, University of Delaware, Newark, Delaware 19716 (United States)



Nickel deficiency in RENi2-xP2 (RE=La, Ce, Pr). Combined crystallographic and physical property studies  

Science Conference Proceedings (OSTI)

Large single crystals from RENi{sub 2-x}P{sub 2} (RE = La, Ce, Pr) were synthesized from the pure elements using Sn as a metal flux, and their structures were established by X-ray crystallography. The title compounds were confirmed to crystallize in the body-centered tetragonal ThCr{sub 2}Si{sub 2} structure type (space group I4/mmm (No. 139); Pearson's symbol tI10), but with a significant stoichiometry breadth with respect to the transition metal. Systematic synthetic work, coupled with accurate structure refinements indicated strong correlation between the degree of Ni-deficiency and the reaction conditions. For four different PrNi{sub 2-x}P{sub 2} (x {le} 0.5) samples, temperature dependent dc magnetization measurements indicated typical local moment 4f-magnetism and a stable Pr{sup 3+} ground state. Field-dependent heat capacity data confirmed a ferromagnetic order at low temperature, and the variations of T{sub c} with the concentration of Ni defects are discussed. LaNi{sub 2-x}P{sub 2}, as expected was found to be Pauli-like paramagnetic in the studied temperature regime, while the Ce-analog CeNi{sub 2-x}P{sub 2} (x = 0.28(1)) showed the characteristics of a mixed valent Ce{sup 3+}/Ce{sup 4+} system with a possible Kondo temperature on the order of 230 K.

Bauer, Eric D [Los Alamos National Laboratory; Ronning, Filip [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Sarrao, John L [Los Alamos National Laboratory; Bobev, S [U. OF DE; Xia, S [U. OF DE



High-temperature electron-hole transport in PrBaCo{sub 2}O{sub 5+{delta}}  

SciTech Connect

The oxygen content, conductivity and thermopower in the double perovskite-like cobaltite PrBaCo{sub 2}O{sub 5+{delta}} are reported in the oxygen partial pressure range 2x10{sup -6}-0.21 atm and temperatures between 650 and 950 deg. C. The electrical properties are shown to be continuous through the transition from {delta}>0.5 to {delta}<0.5. The variations of transport parameters with temperature and oxygen content reveal hole polaron hopping conduction within oxygen non-stoichiometry domain {delta}<0.5. - Graphical abstract: Electrical properties in PrBaCo{sub 2}O5+{delta} depending on oxygen content at 800 deg. C. Highlights: > The oxygen content in PrBaCo{sub 2}O{sub 5+{delta}} is studied depending on temperature and oxygen partial pressure. > The transport parameter variations reveal hole polaron conduction. > The electrical properties are continuous through the transition from {delta}>0.5 to {delta}<0.5.

Suntsov, A.Yu., E-mail: suntsov@ihim.uran.ru [Institute of Solid State Chemistry, Yekaterinburg 620990 (Russian Federation); Leonidov, I.A.; Patrakeev, M.V.; Kozhevnikov, V.L. [Institute of Solid State Chemistry, Yekaterinburg 620990 (Russian Federation)



Pr and Cu magnetism in (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}MO{sub 10{minus}{delta}} (M=Nb, Ta): Correlations with a suppression of superconductivity  

Science Conference Proceedings (OSTI)

The magnetic properties of nonsuperconducting (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}MO{sub 10{minus}{delta}} with M=Nb, Ta are characterized with dc magnetization, specific-heat, and neutron-diffraction experiments. Data for (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}NbO{sub 10{minus}{delta}} reveal complex Cu magnetism marked by antiferromagnetic order below 200 K, spin structure transitions at 130 and 57 K, both collinear and noncollinear antiferromagnetic spin structures, and weak ferromagnetic behavior below 130 K. The data also indicate an anomalous ordering of the Pr spins near 10 K, a large linear contribution to the low-temperature specific heat, and a Pr 4f crystal-field ground state similar to that found in PrBa{sub 2}Cu{sub 3}O{sub 7}. Furthermore, there is evidence that the weak ferromagnetic behavior couples to the Pr ordering near 10 K. Identical Pr magnetism and similar Cu magnetism are found in (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}TaO{sub 10{minus}{delta}}, deoxygenated (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}NbO{sub 10{minus}{delta}}, and deoxygenated (Pr{sub 1.5}Ce{sub 0.5})Sr{sub 2}Cu{sub 2}TaO{sub 10{minus}{delta}}. These results indicate that superconductivity is suppressed in these compounds in the same phenomenological manner as in PrBa{sub 2}Cu{sub 3}O{sub 7}. We interpret this as evidence that superconductivity is suppressed by the same mechanism in both structures and propose that a general correlation exists between anomalous Pr magnetism and a lack of superconductivity in these Pr-based high-T{sub C} cuprates. The significance of these results and analyses to understanding and modeling the suppression of superconductivity by Pr in high-T{sub C} cuprates is discussed. {copyright} {ital 1997} {ital The American Physical Society}

Goodwin, T.J.; Shelton, R.N. [Department of Physics, University of California, Davis, California 95616 (United States); Radousky, H.B. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)]|[Department of Physics, University of California, Davis, California 95616 (United States); Rosov, N.; Lynn, J.W. [Reactor Radiation Division, National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States)



Anomalous Chemical Expansion Behavior of Pr[subscript 0.2]Ce[subscript 0.8]O[subscript 2-?] Thin Films Grown by Pulsed Laser Deposition  

E-Print Network (OSTI)

The chemomechanical and electrical properties of (Pr,Ce)O[subscript 2-?] thin films were studied between 30 and 875C in air by in situ X-ray diffraction and complex impedance spectroscopy measurements. Reduction/oxidation ...

Kuru, Y.


High-temperature crystal structure and transport properties of the layered cuprates Ln{sub 2}CuO{sub 4}, Ln=Pr, Nd and Sm  

SciTech Connect

High-temperature crystal structure of the layered cuprates Ln{sub 2}CuO{sub 4}, Ln=Pr, Nd and Sm with tetragonal T'-structure was refined using X-ray powder diffraction data. Substantial anisotropy of the thermal expansion behavior was observed in their crystal structures with thermal expansion coefficients (TEC) along a- and c-axis changing from TEC(a)/TEC(c){approx}1.37 (Pr) to 0.89 (Nd) and 0.72 (Sm). Temperature dependence of the interatomic distances in Ln{sub 2}CuO{sub 4} shows significantly lower expansion rate of the chemical bond between Pr and oxygen atoms (O1) belonging to CuO{sub 2}-planes (TEC(Pr-O1)=11.7 ppm K{sup -1}) in comparison with other cuprates: TEC (Nd-O1)=15.2 ppm K{sup -1} and TEC (Sm-O1)=15.1 ppm K{sup -1}. High-temperature electrical conductivity of Pr{sub 2}CuO{sub 4} is the highest one in the whole studied temperature range (298-1173 K): 0.1-108 S/cm for Pr{sub 2}CuO{sub 4}, 0.07-23 S/cm for Nd{sub 2}CuO{sub 4} and 2x10{sup -4}-9 S/cm for Sm{sub 2}CuO{sub 4}. The trace diffusion coefficient (D{sub T}) of oxygen for Pr{sub 2}CuO{sub 4} determined by isotopic exchange depth profile (IEDP) technique using secondary ion mass spectrometry (SIMS) varies in the range 7.2x10{sup -13} cm{sup 2}/s (973 K) and 3.8x10{sup -10} cm{sup 2}/s (1173 K) which are in between those observed for the manganese and cobalt-based perovskites. -- Graphical abstract: Anomaly anisotropic thermal expansion behavior was observed for Pr{sub 2}CuO{sub 4} in comparison with Ln{sub 2}CuO{sub 4}, Ln=Pr and Nd having tetragonal T'-structure with thermal expansion coefficients (TEC) along a- and c-axis changing from TEC(a)/TEC(c){approx}1.37 (Pr) to 0.89 (Nd) and 0.72 (Sm). It was found that the trace diffusion coefficient (D{sub T}) of oxygen in Pr{sub 2}CuO{sub 4} determined by secondary ion mass spectrometry (SIMS) varies in the range 7.2x10{sup -13} cm{sup 2}/s (973 K) and 3.8x10{sup -10} cm{sup 2}/s (1173 K) which are in between those observed for the manganese and cobalt-based perovskites. Display Omitted Research highlights: {yields} Anisotropic high-temperature thermal expansion behavior of T'-Ln{sub 2}CuO{sub 4}, Ln=Pr, Nd and Sm. {yields} Anomalous expansion behavior of Pr{sub 2}CuO{sub 4} in comparison with Ln{sub 2}CuO{sub 4}, Ln=Nd and Sm. {yields} High-temperature electrical conductivity of Pr{sub 2}CuO{sub 4} is higher in comparison with other T'-Ln{sub 2}CuO{sub 4}. {yields} Values of the oxygen trace diffusion coefficient for Pr{sub 2}CuO{sub 4} are between those reported for the Mn- and Co-based perovskites.

Kaluzhskikh, M.S.; Kazakov, S.M.; Mazo, G.N. [Department of Chemistry, Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Istomin, S.Ya., E-mail: istomin@icr.chem.msu.r [Department of Chemistry, Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Antipov, E.V. [Department of Chemistry, Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Gippius, A.A. [Department of Physics, Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Fedotov, Yu.; Bredikhin, S.I. [Institute of Solid State Physics RAS, 142432 Chernogolovka, Moscow Region (Russian Federation); Liu, Yi; Svensson, G.; Shen, Z. [Department of Materials and Environmental Chemistry, Stockholm University, S-10691 Stockholm (Sweden)



Implications for advanced safeguards derived from PR&PP case study results  

SciTech Connect

The proliferation resistance and physical protection (PR and PP) working group produced a case study on the Example Sodium Fast Reactor (ESFR). The ESFR is a hypothetical nuclear energy system consisting of four sodium-cooled fast reactors of medium size collocated with an on-site dry fuel storage facility and a spent fuel reprocessing facility using pyroprocessing technology. This study revealed how safeguards would be applied at such site consisting of integrated multiple fuel cycle facilities and the implications of what safeguards technology and safeguards concepts would need to be adapted and developed to safeguard successfully this Generation IV nuclear energy system concept. The major safeguards concepts driving our safeguards analysis are timeliness goals and material quantity goals. Because the fresh transuranic (TRU) fuel to be produced in the ESFR fuel fabrication facility contains plutonium, the ESFR will be reprocessing, using in the reactor, and storing material on site that will have IAEA defined 'direct-use material' in it with stringent timeliness goals and material quantity goals that drive the safeguards implementation. Specifically, the TRU fresh fuel, pyroprocessing in process material, LWR spent fuel sent to the ESFR, and TRU spent fuel will contain plutonium. This material will need to be verified at interim intervals four times per year because the irradiated direct-use material, as defined previously, has three-month timeliness goals and 8 kg material quantity goals for plutonium. The TRU in-process material is, of course, irradiated direct-use material as defined by the IAEA. Keeping the plutonium and uranium together with TRu products should provide a radiation barrier. this radiation barrier slows down the ability to reprocess the fuel. Furthermore, the reprocessing technique, if it has some intrinsic proliferation resistance, will need major modifications to be able to separate plutonium from the uranium and TRU mixture. The ESFR design should have such features in it if it is seen to have intrinsic proliferation resistance. The technical difficulty in diverting material from the ESFR is at least as strongly impacted by the adversaries overall technical capabilities as it is by the effort required to overcome those barriers intrinsic to the nuclear fuel cycle. The intrinsic proliferation resistance of the ESFR will affect how extrinsic measures in the safeguards approach for the ESFR will provide overall proliferation resistance.

Boyer, Brian D [Los Alamos National Laboratory



Spectroscopy and decay kinetics of Pr{sup 3+}-doped chloride crystals for 1300-nm optical amplifiers  

Science Conference Proceedings (OSTI)

Several Pr{sup 3+}-doped chloride crystals have been tested spectroscopically for suitability as 1300-nm optical amplifiers operating on the {sup 1}G{sub 4} - {sup 3}H{sub 5} transition. {sup 1}G{sub 4} lifetimes are much longer than in fluoride hosts, ranging up to 1300 {mu}sec and suggesting a near-unity luminescence quantum yield. Emission spectra are typically broad (FWHM {approximately} 70 nm) and include the 1310-nm zero-dispersion wavelength of standard telecommunications fiber.

Page, R.H.; Schaffers, K.I.; Wilke, G.D. [and others


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:244cda0a-21fd-4059-889a-12a0147a129b | Open Energy Information  

Open Energy Info (EERE)

a-21fd-4059-889a-12a0147a129b a-21fd-4059-889a-12a0147a129b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Monroe, North Carolina (Utility Company) Effective date: 2013/06/01 End date if known: Rate name: Schedule TS - Traffic Signal Service Sector: Lighting Description: Source or reference: http://www.monroenc.org/services.php?cat=150 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:1844e12d-12a3-4722-a554-be3c170bffaa | Open Energy Information  

Open Energy Info (EERE)

e12d-12a3-4722-a554-be3c170bffaa e12d-12a3-4722-a554-be3c170bffaa No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Tell City, Indiana (Utility Company) Effective date: 2008/07/01 End date if known: Rate name: Tariff A1: Single Phase Residential, Greater Than 200 Amps and Less Than 400 Amps Sector: Residential Description: The charges derived in the Tariff A1 rate are subject to adjustment for: Purchased Power Adjustment Tracking Factor. Source or reference: Rates Binder 1, Illinois State University Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months):


Data:33d1657d-8616-4475-94a0-e6ed12a79571 | Open Energy Information  

Open Energy Info (EERE)

d1657d-8616-4475-94a0-e6ed12a79571 d1657d-8616-4475-94a0-e6ed12a79571 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Belmont, Wisconsin (Utility Company) Effective date: 2005/01/21 End date if known: Rate name: Rg-1 Residential Service Single Phase Sector: Residential Description: This rate will be applied to residential single phase customers for ordinary household purposes. Single-Phase motors may not exceed 5 horsepower individual-rated capacity without utility permission. Fixed Monthly Charge includes Commitment to Community Rider: $1.00 per customer per month Source or reference: http://psc.wi.gov/apps40/tariffs/viewfile.aspx?type=electric&id=440


Preparation and structural study from neutron diffraction data of Pr{sub 5}Mo{sub 3}O{sub 16}  

SciTech Connect

The title compound has been prepared as polycrystalline powder by thermal treatments of mixtures of Pr{sub 6}O{sub 11} and MoO{sub 2} in air. In the literature, an oxide with a composition Pr{sub 2}MoO{sub 6} has been formerly described to present interesting catalytic properties, but its true stoichiometry and crystal structure are reported here for the first time. It is cubic, isostructural with CdTm{sub 4}Mo{sub 3}O{sub 16} (space group Pn-3n, Z=8), with a=11.0897(1) A. The structure contains MoO{sub 4} tetrahedral units, with Mo-O distances of 1.788(2) A, fully long-range ordered with PrO{sub 8} polyhedra; in fact it can be considered as a superstructure of fluorite (M{sub 8}O{sub 16}), containing 32 MO{sub 2} fluorite formulae per unit cell, with a lattice parameter related to that of cubic fluorite (a{sub f}=5.5 A) as a{approx}2a{sub f}. A bond valence study indicates that Mo exhibits a mixed oxidation state between 5+ and 6+ (perhaps accounting for the excellent catalytic properties). One kind of Pr atoms is trivalent whereas the second presents a mixed Pr{sup 3+}-Pr{sup 4+} oxidation state. The similarity of the XRD pattern with that published for Ce{sub 2}MoO{sub 6} suggests that this compound also belongs to the same structural type, with an actual stoichiometry Ce{sub 5}Mo{sub 3}O{sub 16}. -- Graphical Abstract: Formerly formulated as Pr{sub 2}MoO{sub 6}, the title compound is a cubic superstructure of fluorite (a=11.0897(1) A, space group Pn-3n) due to the long-range ordering of PrO{sub 8} scalenohedra and MoO{sub 4} tetrahedral units, showing noticeable shifts of the oxygen positions in order to provide a tetrahedral coordination for Mo ions. A mixed valence Mo{sup 5+}-Mo{sup 6+} is identified, which could account for the excellent catalytic properties of this material. Display Omitted

Martinez-Lope, M.J. [Instituto de Ciencia de Materiales de Madrid, C.S.I.C., Cantoblanco, E-28049 Madrid, Spain. (Spain); Alonso, J.A., E-mail: ja.alonso@icmm.csic.e [Instituto de Ciencia de Materiales de Madrid, C.S.I.C., Cantoblanco, E-28049 Madrid, Spain. (Spain); Sheptyakov, D.; Pomjakushin, V. [Laboratory for Neutron Scattering, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)




NLE Websites -- All DOE Office Websites (Extended Search)

REGISTRATION LIST REGISTRATION LIST P PR RE ES SO OL LI IC CI IT TA AT TI IO ON N C CO ON NF FE ER RE EN NC CE E August 9, 2011 Holiday Inn Capitol  550 C Street, SW  Washington, DC 20024 Page 1 of 9 Instructions: (iii) Please indicate (by checking the appropriate box) whether the organization you represent is a large business, small business, or not a business. (iv) Please indicate (by checking the appropriate box) whether your name or the name of your organization may be released on the NNSA website as an attendee of this conference. (v) Please provide an email address if you would like it to be released on the NNSA website. An email address cannot be released if you select neither in column (iv). Name Organization Name Large/Small (iii) Release Attendance? (iv) Email (to release)


A Qualitative Assessment of Diversion Scenarios for an Example Sodium Fast Reactor Using the GEN IV PR&PP Methodology  

Science Conference Proceedings (OSTI)

FAST REACTORS;NUCLEAR ENERGY;NUCLEAR MATERIALS MANAGEMENT;PROLIFERATION;SAFEGUARDS;THEFT; A working group was created in 2002 by the Generation IV International Forum (GIF) for the purpose of developing an internationally accepted methodology for assessing the Proliferation Resistance of a nuclear energy system (NES) and its individual elements. A two year case study is being performed by the experts group using this methodology to assess the proliferation resistance of a hypothetical NES called the Example Sodium Fast Reactor (ESFR). This work demonstrates how the PR and PP methodology can be used to provide important information at various levels of details to NES designers, safeguard administrators and decision makers. The study analyzes the response of the complete ESFR nuclear energy system to different proliferation and theft strategies. The challenges considered include concealed diversion, concealed misuse and 'break out' strategies. This paper describes the work done in performing a qualitative assessment of concealed diversion scenarios from the ESFR.

Zentner, Michael D.; Coles, Garill A.; Therios, Ike



Investigation of PR and TMI Version 6 and Version 7 Rainfall Algorithms in Landfalling Tropical Cyclones Relative to the NEXRAD Stage-IV Multisensor Precipitation Estimate Dataset  

Science Conference Proceedings (OSTI)

Rainfall estimates from versions 6 (V6) and 7 (V7) of the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) 2A25 and Microwave Imager (TMI) 2A12 algorithms are compared relative to the Next Generation Weather Radar (NEXRAD) ...

Joseph P. Zagrodnik; Haiyan Jiang



Proton Delivery and Removal in [Ni(PR2NR?2)2]2+ Hydrogen Production and Oxidation Catalysts  

SciTech Connect

To examine the role of proton delivery and removal in the electrocatalytic oxidation and production of hydrogen by [Ni(PR2NR)2]2+ (where PR2NR2 is 1,5-R-3,7-R-1,5-diaza-3,7-diphosphacyclooctane), we report experimental and theoretical studies of the intermolecular proton exchange reactions underlying the isomerization of [Ni(PCy2NBn2H)2]2+ (Cy = cyclohexyl, Bn = benzyl) species formed during the stochiometric oxidation of H2 by [NiII(PCy2NBn2)2]2+ or the protonation of [Ni0(PCy2NBn2)2]. The three isomers formed differ by the position of the N-H bond with respect to the nickel (endo-endo, endo-exo, or exo-exo) and only the endo-endo isomer is catalytically active. We have found that the rate of isomerization is limited by proton removal from and delivery to the complex. In particular, steric hindrance disfavors the catalytically active protonation site (endo to the metal) in favor of inactive protonation (exo to the metal). The ramifications to catalysis of poor accessibility of the endo site and protonation at the exo site are discussed. In hydrogen oxidation, deprotonation of the sterically hindered endo position by an external base may lead to slow catalytic turnover. As for hydrogen production, the limited accessibility of the endo position can result in the formation of exo protonated species, which must undergo one or more isomerization steps to generate the catalytically active endo protonated species. These studies highlight the importance of precise proton delivery, and the mechanistic details described herein will guide future catalyst design. This research was carried out in the Center for Molecular Electrocatalysis, an Energy Frontier Research Center funded by the U.S. Department of Energy, Office of Science. WJS was funded by the DOE Office of Science Early Career Research Program through the Office of Basic Energy Sciences. Pacific Northwest National Laboratory is operated for the U.S. Department of Energy by Battelle. Computational resources were provided at W. R. Wiley Environmental Molecular Science Laboratory (EMSL), a national scientific user facility sponsored by the Department of Energys Office of Biological and Environmental Research located at Pacific Northwest National Laboratory; the National Energy Research Scientific Computing Center (NERSC) at Lawrence Berkeley National Laboratory; and the Jaguar supercomputer at Oak Ridge National Laboratory (INCITE 2008-2011 award supported by the Office of Science of the U.S. DOE under Contract No. DE-AC0500OR22725).

O'Hagan, Molly J.; Ho, Ming-Hsun; Yang, Jenny Y.; Appel, Aaron M.; Rakowski DuBois, Mary; Raugei, Simone; Shaw, Wendy J.; DuBois, Daniel L.; Bullock, R. Morris



Nickel deficiency in RENi{sub 2-x}P{sub 2} (RE=La, Ce, Pr). Combined crystallographic and physical property studies  

SciTech Connect

Large single crystals from RENi{sub 2-x}P{sub 2} (RE=La, Ce, Pr) were synthesized from the pure elements using Sn as a metal flux, and their structures were established by X-ray crystallography. The title compounds were confirmed to crystallize in the body-centered tetragonal ThCr{sub 2}Si{sub 2} structure type (space group I4/mmm (No. 139); Pearson's symbol tI10), but with a significant homogeneity range with respect to the transition metal. Systematic synthetic work, coupled with accurate structure refinements indicated strong correlation between the degree of Ni-deficiency and the reaction conditions. According to the temperature dependent dc magnetization measurements, LaNi{sub 2-x}P{sub 2} (x=0.30(1)), as expected, is Pauli-like paramagnetic in the studied temperature regime, while the Ce-analog CeNi{sub 2-x}P{sub 2} (x=0.28(1)) shows the characteristics of a mixed valent Ce{sup 3+}/Ce{sup 4+} system with a possible Kondo temperature scale on the order of 1000 K. For three different PrNi{sub 2-x}P{sub 2} (x<=0.5) samples, the temperature and field dependence of the magnetization indicated typical local moment 4f-magnetism and a stable Pr{sup 3+} ground state, with subtle variations of T{sub C} as a function of the concentration of Ni defects. Field-dependent heat capacity data for CeNi{sub 2-x}P{sub 2} (x=0.28(1)) and PrNi{sub 2-x}P{sub 2} (x=0.53(1)) are discussed as well. - Graphical abstract: The non-stoichiometric RENi{sub 2-x}P{sub 2} phases (RE=La, Ce, Pr), whose average structure belongs to the ThCr{sub 2}Si{sub 2} type, are shown to exist with a wide range of defects on the transition metal site. The changes in the Ni-underoccupancy affect the magnetism of the synthesized materials.

Bobev, Svilen, E-mail: bobev@udel.ed [Department of Chemistry and Biochemistry, University of Delaware, Newark, DE 19716 (United States); Xia, Sheng-qing [Department of Chemistry and Biochemistry, University of Delaware, Newark, DE 19716 (United States); Bauer, Eric D.; Ronning, Filip; Thompson, Joe D.; Sarrao, John L. [Materials Physics and Applications Division (MPA-10), Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)



Synthesis and crystal structure of the isotypic rare earth thioborates Ce[BS{sub 3}], Pr[BS{sub 3}], and Nd[BS{sub 3}  

Science Conference Proceedings (OSTI)

The orthothioborates Ce[BS{sub 3}], Pr[BS{sub 3}] and Nd[BS{sub 3}] were prepared from mixtures of the rare earth (RE) metals together with amorphous boron and sulfur summing up to the compositions CeB{sub 3}S{sub 6}, PrB{sub 5}S{sub 9} and NdB{sub 3}S{sub 6}. The following preparation routes were used: solid state reactions with maximum temperatures of 1323 K and high-pressure high-temperature syntheses at 1173 K and 3 GPa. Pr[BS{sub 3}] and Nd[BS{sub 3}] were also obtained from rare earth chlorides RECl{sub 3} and sodium thioborate Na{sub 2}B{sub 2}S{sub 5} by metathesis type reactions at maximum temperatures of 1073 K. The crystal structure of the title compounds was determined from X-ray powder diffraction data. The thioborates are isotypic and crystallize in the orthorhombic spacegroup Pna2{sub 1} (No. 33; Z=4; Ce: a=7.60738(6)A, b=6.01720(4)A, c=8.93016(6)A; Pr: a=7.56223(4)A, b=6.00876(2)A, c=8.89747(4)A; Nd: a=7.49180(3)A, b=6.00823(2)A, c=8.86197(3)A) . The crystal structures contain isolated [BS{sub 3}]{sup 3-} groups with boron in trigonal-planar coordination. The sulfur atoms form the vertices of undulated kagome nets, which are stacked along [100] according to the sequence ABAB. Within these nets every second triangle is occupied by boron and the large hexagons are centered by rare earth ions, which are surrounded by overall nine sulfur species. - Abstract: Graphical Abstract Legend (TOC Figure): Table of Contents Figure The isotypic orthothioborates Ce[BS{sub 3}], Pr[BS{sub 3}] and Nd[BS{sub 3}] were prepared using different preparation routes. The crystal structure of the title compounds was determined from X-ray powder diffraction data. The crystal structures contain isolated [BS{sub 3}]{sup 3-} groups with boron in trigonal-planar coordination. The sulfur atoms form the vertices of corrugated kagome nets (sketched with blue dotted lines), which are stacked along [100] according to the sequence ABAB. Within these nets every second triangle is occupied by boron and the large hexagons are centered by rare earth ions, which are surrounded by overall nine sulfur species.

Hunger, Jens; Borna, Marija [Max Planck Institute for Chemical Physics of Solids, Noethnitzer Strasse 40, D-01187 Dresden (Germany); Kniep, Ruediger, E-mail: kniep@cpfs.mpg.d [Max Planck Institute for Chemical Physics of Solids, Noethnitzer Strasse 40, D-01187 Dresden (Germany)



PR Baldrige App 2001  

Science Conference Proceedings (OSTI)

... share of enrollment Student satisfaction rate Prospective homeowner requests New ... firm; Focus groups conducted according to industry standards ...



Data:82153c86-4996-4b06-b372-b6e1c0bcb1a3 | Open Energy Information  

Open Energy Info (EERE)

4996-4b06-b372-b6e1c0bcb1a3 4996-4b06-b372-b6e1c0bcb1a3 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mid-Kansas Electric Company, LLC (MKEC) Effective date: 2010/01/14 End date if known: Rate name: General Service Small-Heating Service(30% of the Load or more) Sector: Commercial Description: Entire Service Area. To all electric service of a single character supplied at one point of delivery and used for general business or commercial purposes. Where the the customer has installed and in regular use electric space heating that is not less than 30% of the total connected load,the demand used for billing purposes in the billing months of November 1 through June 30 shall not exceed the highest similarly established in the next preceding billing months of July, August,September, or October.


Data:D2c86fec-dd50-4485-b638-365a79d904b8 | Open Energy Information  

Open Energy Info (EERE)

fec-dd50-4485-b638-365a79d904b8 fec-dd50-4485-b638-365a79d904b8 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Eagle River, Wisconsin (Utility Company) Effective date: 2009/08/04 End date if known: Rate name: Rg-2 Residential Service Single Phase - Optional Time-of-Day 8am-8pm Sector: Residential Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base


Data:C86f705a-e082-49e4-9622-df4009777a6a | Open Energy Information  

Open Energy Info (EERE)

5a-e082-49e4-9622-df4009777a6a 5a-e082-49e4-9622-df4009777a6a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Williams - AZ, Arizona (Utility Company) Effective date: 2013/04/01 End date if known: Rate name: Customer owned Lights(20,000 Lumens 400 W MV-Pole) Sector: Commercial Description: Source or reference: Rate Binder#4 (Illinois State University) Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:


Data:C86e738f-76dc-4017-8438-9c27ee94a81f | Open Energy Information  

Open Energy Info (EERE)

8f-76dc-4017-8438-9c27ee94a81f 8f-76dc-4017-8438-9c27ee94a81f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Cotton Electric Coop, Inc Effective date: 2010/02/01 End date if known: Rate name: Commercial Time -Of- Use Service-Single Phase Sector: Commercial Description: * Available for commercial customers up to 50 kVA of transformer capacity. Further capacity available at the discretion of the Cooperative, up to 150 kVA. Subject to power cost adjustment and tax adjustment on-Peak period is June 20 through September 9, from 4p.m to 8p.m Source or reference: ISU Documentation Rate Binder Kelly # 4


Data:58c86e88-9e30-4f65-bdff-6272a8b65832 | Open Energy Information  

Open Energy Info (EERE)

6e88-9e30-4f65-bdff-6272a8b65832 6e88-9e30-4f65-bdff-6272a8b65832 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Sawnee Electric Membership Corporation Effective date: 2012/06/01 End date if known: Rate name: Outdoor Lighting Cobrahead/Ornamental MH 1000 W Sector: Lighting Description: *Wood Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $600 per 30 foot wood pole, ii. $625 per 35 foot wood pole, Standard Ornamental Fixtures and Standard Ornamental Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $ 525 per 22 foot fiberglass pole; ii. $1,450 per 35 foot fiberglass pole;


Data:778b13cc-ea21-4011-939c-c86bb46e2fc2 | Open Energy Information  

Open Energy Info (EERE)

experts. Jump to: navigation, search Loading... edit 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Tacoma,...


Data:5e4ccfac-015b-4c86-bd8f-c989ab125ff2 | Open Energy Information  

Open Energy Info (EERE)

operating, or contracting with other persons to own, operate, or both a renewable fuel generator that (i) uses as its total fuel source sunlight, wind, hydro, energy waste, wave...


Data:F9ff9ce4-e5c1-4374-a891-f0c86cecd291 | Open Energy Information  

Open Energy Info (EERE)

rate shall not exceed 100 kWh for three or more months in a consecutive 12-month period. Power Cost Adjustment Clause (PCAC) - Charge per all kWh varies monthly. Source or...


Data:F656db87-078b-4e81-b40a-6c86c186be80 | Open Energy Information  

Open Energy Info (EERE)

Residential Rate: Brevig Mission Village Sector: Residential Description: For 1-500 kWh consumed: Rate ( .30 + Cost of Fuel) - (PCE Adjustment) For 501-700 kWh consumed:...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Chains of centered metal clusters with a novel range of distortions: Pr[sub 3]I[sub 3]Ru, Y[sub 3]I[sub 3]Ru, and Y[sub 3]I[sub 3]Ir  

SciTech Connect

The phases R[sub 3]I[sub 3]Ru (R = La, Pr, Gd, Y, Er) and R[sub 3]I[sub 3]Ir (R = Gd, Y) are obtained from the reactions of R, RI[sub 3], and Ru or Ir for 3-4 weeks in sealed Ta tubing at 850-975C, depending on the system. The title phases have been characterized by single-crystal X-ray means at room temperature. The first phase contains quasi-infinite double chains of edge-sharing Pr[sub 6](Ru) octahedra that are sheathed and interbridged by iodine. An evidently continuous distortion of these chains parallels the a/b axial ratio (in the order listed in the first sentence) such that metal octahedra are no longer obvious in Y[sub 3]I[sub 3]Ir; rather chains of trans-edge-sharing square pyramidal Y[sub 4]Ir units bonded base-to-base are more apt. Increased R-R, R-interstitial, and interstitial-interstitial bonding appears to parallel the degree of distortion. Magnetic data for La[sub 3]I[sub 3]Ru and Pr[sub 3]I[sub 3]Ru and the results of extended Hueckel band calculations on Pr[sub 3]I[sub 3]Ru are reported. Polar covalent Pr-Ru interactions and at least a quasi-closed shell configuration are emphasized by the latter.

Payne, M.W.; Dorhout, P.K.; Kim, Sungjin; Hughbanks, T.R.; Corbett, J.D. (Iowa State Univ., Ames (United States) Texas A and M Univ., College Station (United States))



A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM o  

Office of Legacy Management (LM)

A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM of A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr a m?neral 7m~rM of metallurKic.%l, fabrication, and nhysicnf stuJles whtch owht to be carried out as lntcnsively as -loseible stnrtinr: imiaedintely, in order to Tmvide information for the desicn of efficient methods of using atomic noxer. This nrescnt memo becomes more snecific in q entionini: lines of vmr!: which the idetholis and iinterlals Section believes to bc of lnortence. It also tells names of neonle and olaces where useful eouinment is available. The stu;lies may be divided into 5 mats: .:. .,.. I. Phases of tiec1a.l Metals end Their tiloys II. Fahrlcntion III. corrosion IV. Heat Transfer and Fluid Flow 7. Snecial 'Jhysical Tests I. Phases of Soecial Hetale and Their Alloys (Written by E. Creutz and 3. &wine@)


Characterisation of [11C]PR04.MZ in Papio anubis baboon: A selective high-affinity radioligand for quantitative imaging of the dopamine transporter  

SciTech Connect

N-(4-fluorobut-2-yn-1-yl)-2{beta}-carbomethoxy-3{beta}-(4{prime}-tolyl)nortropane (PR04.MZ, 1) is a PET radioligand for the non-invasive exploration of the function of the cerebral dopamine transporter (DAT). A reliable automated process for routine production of the carbon-11 labelled analogue [{sup 11}C]PR04.MZ ([{sup 11}C]-1) has been developed using GMP compliant equipment. An adult female Papioanubis baboon was studied using a test-retest protocol with [{sup 11}C]-1 in order to assess test-retest reliability, metabolism and CNS distribution profile of the tracer in non-human primates. Blood sampling was performed throughout the studies for determination of the free fraction in plasma (fP), plasma input functions and metabolic degradation of the radiotracer [{sup 11}C]-1. Time-activity curves were derived for the putamen, the caudate nucleus, the ventral striatum, the midbrain and the cerebellum. Distribution volumes (VT) and non-displaceable binding potentials (BPND) for various brain regions and the blood were obtained from kinetic modelling. [{sup 11}C]-1 shows promising results as aselective marker of the presynaptic dopamine transporter. With the reliable visualisation of the extra-striatal dopaminergic neurons and no indication on labelled metabolites, the tracer provides excellent potential for translation into man.

Riss P. J.; Fowler J.; Riss, P.J.; Hooker, J.M.; Shea, C.; Xu, Y.; Carter, P.; Warner, D.; Ferrari V.; Kim, S.W.; Aigbirhio, F.I.; Fowler, J.S.; Roesch, F.



Data:D5afa075-e887-4728-97a1-2a2bc811845d | Open Energy Information  

Open Energy Info (EERE)

afa075-e887-4728-97a1-2a2bc811845d afa075-e887-4728-97a1-2a2bc811845d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Rochester Public Utilities Effective date: 2009/01/01 End date if known: Rate name: SECURITY LIGHTING(250 Watt HPS) Sector: Lighting Description: At all locations whenever the service can be provided with overhead wiring on an existing RPU owned pole. Source or reference: http://www.rpu.org/documents/2012_rate_schedule.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage


Data:Ad262f27-c738-4d12-a3a0-0c0b5f53221a | Open Energy Information  

Open Energy Info (EERE)

62f27-c738-4d12-a3a0-0c0b5f53221a 62f27-c738-4d12-a3a0-0c0b5f53221a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Singing River Elec Pwr Assn (Mississippi) Effective date: 2009/12/04 End date if known: Rate name: Security Lighting MV 175 W Post Top (Includes Pole) Sector: Lighting Description: *Subject to power cost adjustment, tax expense adjustment, and an environmental compliance charge. Source or reference: http://www.singingriver.com/Files/R-18.pdf Source Parent: Comments Energy Adjustment is Power Cost Adjustment plus Environmental Clause plus Regulatory Adjustment Applicability Demand (kW)


Data:F1983099-90dc-4b12-a937-bc3c29638f2d | Open Energy Information  

Open Energy Info (EERE)

99-90dc-4b12-a937-bc3c29638f2d 99-90dc-4b12-a937-bc3c29638f2d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mt Carmel Public Utility Co Effective date: End date if known: Rate name: Residential Sector: Residential Description: AVAILABILITY Available for any customer for Company's standard service for residential purposes. Where a residence and business are combined in one premise, the service classification shall be determined by the predominant electric use at the premise. Source or reference: http://www.mtcpu.com/includes/tariff_electric.htm?t=Residential_Electric_Service Source Parent:


Data:B04aa56c-12a5-43dc-86dd-3355e2a5cd72 | Open Energy Information  

Open Energy Info (EERE)

6c-12a5-43dc-86dd-3355e2a5cd72 6c-12a5-43dc-86dd-3355e2a5cd72 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Wild Rice Electric Coop, Inc Effective date: 2012/03/18 End date if known: Rate name: FARM AND HOME SERVICE - Up to 15 KVA transformer Sector: Residential Description: Source or reference: http://www.wildriceelectric.com/b-rate.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 | Open Energy Information  

Open Energy Info (EERE)

7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 7e12a3cc-a6ed-40c3-acfc-dffb0212ba16 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Moorhead, Minnesota (Utility Company) Effective date: End date if known: Rate name: Small General Service/General Service: Dual-Fuel Sector: Commercial Description: Available to Small General Service and General Service customers in conformance with Moorhead Public Service' Source or reference: http://www.mpsutility.com/images/stories/rates/2013/Electric%20Rates.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh)


Data:B04adc72-6615-4040-901d-e4a8b12a0385 | Open Energy Information  

Open Energy Info (EERE)

2-6615-4040-901d-e4a8b12a0385 2-6615-4040-901d-e4a8b12a0385 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Johnson City, Tennessee (Utility Company) Effective date: 2012/08/01 End date if known: Rate name: STREET LIGHTING Sector: Lighting Description: Source or reference: http://www.jcpb.com/yourBusiness/meters/rates.asp#rateSheet Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:Dd3d2c12-a21e-43ef-a56f-eec753ee1976 | Open Energy Information  

Open Energy Info (EERE)

c12-a21e-43ef-a56f-eec753ee1976 c12-a21e-43ef-a56f-eec753ee1976 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Choctaw Electric Coop Inc Effective date: 2008/10/21 End date if known: Rate name: Choctaw Nation Senior Citizens Center Sector: Commercial Description: * Available to the Choctaw Nation for multi-building complexes having electric space heating where more than one building is served from a single transformer. Electric service shall be billed to and paid by the Choctaw Nation on one monthly bill. Subject to Tax Adjustment. Source or reference: Rate binder # 4 Source Parent: Comments


Data:1eed3a36-f12a-4353-b92b-d5c5c0281e45 | Open Energy Information  

Open Energy Info (EERE)

eed3a36-f12a-4353-b92b-d5c5c0281e45 eed3a36-f12a-4353-b92b-d5c5c0281e45 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Three Notch Elec Member Corp Effective date: 2012/03/01 End date if known: Rate name: 175 Mercury vapor with Underground Wiring- (Type - 'MV-Open', Fiberglass Pole) Sector: Lighting Description: Applicable only for dusk to dawn lighting by means of photo-electric controlled, ballast operated vapor lamp luminaries and poles conforming to the Cooperative's specifications. Service will be rendered only at locations that, solely in the opinion of the Cooperative, are readily accessible for installation and maintenance.


Imaging the First-Order Magnetic Transition in La0.35Pr0.275Ca0.375MnO3  

Science Conference Proceedings (OSTI)

The nature of the ferromagnetic, charge, orbital, and antiferromagnetic order in La{sub 0.35}Pr{sub 0.275}Ca{sub 0.375}MnO{sub 3} (LPCMO) on the nano and micro scale was investigated by photoemission electron microscopy (PEEM) and resonant elastic soft x-ray scattering (RSXS). The structure of the ferromagnetic domains around the Curie temperature T{sub C} indicates that they nucleate under a high degree of lattice strain, which is brought about by the charge, orbital, and antiferromagnetic order. The combined temperature-dependent PEEM and RSXS measurements suggest that the lattice distortions associated with charge and orbital order are glassy in nature and that phase separation is driven by the interplay between it and the more itinerant charge carriers associated with ferromagnetic metallic order, even well below T{sub C}.

Burkhardt, Mark



White paper: CeLAND - Investigation of the reactor antineutrino anomaly with an intense 144Ce-144Pr antineutrino source in KamLAND  

E-Print Network (OSTI)

We propose to test for short baseline neutrino oscillations, implied by the recent reevaluation of the reactor antineutrino flux and by anomalous results from the gallium solar neutrino detectors. The test will consist of producing a 75 kCi 144Ce - 144Pr antineutrino source to be deployed in the Kamioka Liquid Scintillator Anti-Neutrino Detector (KamLAND). KamLAND's 13m diameter target volume provides a suitable environment to measure energy and position dependence of the detected neutrino flux. A characteristic oscillation pattern would be visible for a baseline of about 10 m or less, providing a very clean signal of neutrino disappearance into a yet-unknown, "sterile" state. Such a measurement will be free of any reactor-related uncertainties. After 1.5 years of data taking the Reactor Antineutrino Anomaly parameter space will be tested at > 95% C.L.

A. Gando; Y. Gando; S. Hayashida; H. Ikeda; K. Inoue; K. Ishidoshiro; H. Ishikawa; M. Koga; R. Matsuda; S. Matsuda; T. Mitsui; D. Motoki; K. Nakamura; Y. Oki; M. Otani; I. Shimizu; J. Shirai; F. Suekane; A. Suzuki; Y. Takemoto; K. Tamae; K. Ueshima; H. Watanabe; B. D. Xu; S. Yamada; Y. Yamauchi; H. Yoshida; T. Banks; B. E. Berger; M. Cribier; P. Decowski; J. A. Detwiler; M. Durero; D. Dwyer; Y. Efremenko; S. Enomoto; V. Fischer; B. K. Fujikawa; J. Gaffiot; V. M. Gelis; H. J. Karwowski; Yu. G. Kolomensky; A. Kozlov; V. N. Kornoukhov; T. Lasserre; J. G. Learned; A. Letourneau; D. Lhuillier; J. Maricic; D. M. Markoff; S. Matsuno; G. Mention; R. Milincic; T. ODonnell; I. S. Saldikov; L. Scola; G. V. Tikhomirov; Ch. Veyssiere; M. Vivier; S. Yoshida




Gasoline and Diesel Fuel Update (EIA)

1,522 3,228 1,772 18,031 33,384 20,243 84.4 96.7 87.6 Building Floorspace (Square Feet) 1,001 to 5,000 ................................. 193 300 193 2,168 2,904 1,850 89.0 103.2 104.2 5,001 to 10,000 ............................... 134 263 165 2,032 3,217 1,784 66.0 81.9 92.5 10,001 to 25,000 ............................. 241 432 226 3,273 5,679 3,707 73.6 76.1 60.9 25,001 to 50,000 ............................. 181 370 191 2,517 4,518 2,347 71.8 81.8 81.5 50,001 to 100,000 ............................ 156 473 285 2,095 4,763 3,433 74.3 99.3 82.9 100,001 to 200,000 .......................... 219 523 323 2,161 4,706 3,350 101.1 111.1 96.5 200,001 to 500,000 .......................... 221 371 160 2,179 3,623 1,692 101.4 102.3 94.3 Over 500,000 ................................... 179 497 Q 1,606 3,974 2,080 111.2 125.0 Q Principal Building Activity


Investigation of PR and TMI Version 6 and Version 7 Rainfall Algorithms in Landfalling Tropical Cyclones Relative to the NEXRAD Stage-IV Multi-sensor Precipitation Estimate Dataset  

Science Conference Proceedings (OSTI)

Rainfall estimates from Version 6 and Version 7 of the TRMM Precipitation Radar (PR) 2A25 and Microwave Imager (TMI) 2A12 algorithms are compared relative to the NEXRAD Multi-sensor Precipitation Estimate Stage IV hourly rainfall product. The ...

Joseph P. Zagrodnik; Haiyan Jiang


Data:28b54f08-c941-4fd0-93d1-2a577e3dd598 | Open Energy Information  

Open Energy Info (EERE)

8-c941-4fd0-93d1-2a577e3dd598 8-c941-4fd0-93d1-2a577e3dd598 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Puget Sound Energy Inc Effective date: 2013/07/01 End date if known: Rate name: Company Street Lights-120 watt Sector: Lighting Description: Source or reference: http://pse.com/aboutpse/Rates/Documents/elec_sch_053.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>


Data:Bb1cc354-27f0-4e38-a12a-449df422b2f6 | Open Energy Information  

Open Energy Info (EERE)

cc354-27f0-4e38-a12a-449df422b2f6 cc354-27f0-4e38-a12a-449df422b2f6 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Miami-Cass County Rural E M C Effective date: 2011/10/01 End date if known: Rate name: Security Lights Metered 250 watt high pressure sodium Sector: Lighting Description: The Miami-Cass County Rural Electric Membership Corporation (REMC) shall charge and collect for security lighting service on the following bases of availability, character of service, monthly rate, and tax adjustment. AVAILABILITY: Available to any member of the REMC for continuous year round service for outdoor lighting where 120 volt service exists ahead of the meter loop.


Data:37cfd1b4-12a3-480f-ba5b-79db36229eec | Open Energy Information  

Open Energy Info (EERE)

cfd1b4-12a3-480f-ba5b-79db36229eec cfd1b4-12a3-480f-ba5b-79db36229eec No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Groton, South Dakota (Utility Company) Effective date: End date if known: Rate name: Schedule C - HEAT METER Geothermal/Heat Pump Rates Sector: Residential Description: #2 Heat Meter - All kwh at $.08 per kwh Minimum 10 kw resistance backup. Source or reference: http://city.grotonsd.gov/electric.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V):


Data:0c7149ef-adf6-42a7-963d-4b12a98d024d | Open Energy Information  

Open Energy Info (EERE)

ef-adf6-42a7-963d-4b12a98d024d ef-adf6-42a7-963d-4b12a98d024d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Duke Energy Ohio Inc Effective date: 2013/05/06 End date if known: Rate name: Rate OL - Outdoor Lighting Service - MV 400 Watts Sector: Lighting Description: Applicable for outdoor lighting services on private property with Company owned fixtures in the Company's entire service area where secondary distribution lines are adjacent to the premises to be served. Not applicable for lighting public roadways which are dedicated, or anticipated to be dedicated, except to meet the occasional singular need of a customer who has obtained written approval from the proper governmental authority.


Data:638bc389-fb01-4b31-96a5-0c12a8e0261b | Open Energy Information  

Open Energy Info (EERE)

bc389-fb01-4b31-96a5-0c12a8e0261b bc389-fb01-4b31-96a5-0c12a8e0261b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nevada Power Co Effective date: 2013/01/01 End date if known: Rate name: OLGS-1-TOU (Large General Service Time-Of-Use) Sector: Commercial Description: Optional for non-Domestic Service where consumption of energy exceeds 3,500 kWh in any one month, where the Billing Demand is equal to or less than 299 kW in any one month and where time-of-use pricing is requested by the Customer. All service will be supplied at one Point of Delivery and measured through one kilowatthour Meter. Not applicable to standby, resale, temporary, shared, or mixed class of service. Not applicable to supplemental service unless the Customer is a Qualifying Facility under Title 18, Code of Federal Regulations, Section 292.201 through 292.207. This schedule is limited to the addition of 1,000 new Customers per month on all optional time-of-use schedules.

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:Eac1dd3a-0268-4e5c-b1d1-ed9feeb2a12a | Open Energy Information  

Open Energy Info (EERE)

dd3a-0268-4e5c-b1d1-ed9feeb2a12a dd3a-0268-4e5c-b1d1-ed9feeb2a12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Ameren Illinois Company Effective date: 2010/11/19 End date if known: Rate name: DS-2 and BGS-2 Zone 2 - Bundled Small General Delivery Service 600V or Less Sector: Commercial Description: AVAILABILITY Service under this Rate is available for any eligible Non-Residential Customer within the territory served by Company that meets the following criteria: Customers served under this Rate shall have a maximum monthly Demand of less than 150 kilowatts (kW) as qualified in the Delivery Service Rate Reassignment section. A Customer without a demand meter installed, but with an average usage of less than 1,200 kWh per day during each monthly billing period will be normally assumed to have a maximum monthly Demand of less than 150 kW. Where Customer's average daily usage is 1,200 kWh per day or more in any monthly billing period, Company may install a demand meter at Company's expense to determine if Customer remains eligible for service under this Rate.


Data:4bb12a66-235d-4b62-8af0-1e344385ee34 | Open Energy Information  

Open Energy Info (EERE)

4bb12a66-235d-4b62-8af0-1e344385ee34 4bb12a66-235d-4b62-8af0-1e344385ee34 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tri-County Electric Coop, Inc (Florida) Effective date: End date if known: Rate name: Outdoor Lighting MHF 400 W Sector: Lighting Description: Source or reference: http://www.tcec.com/myBusiness/resSinglePhase.aspx Source Parent: http://www.tcec.com/ Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:8100a82f-3ccb-4ce5-b6dc-12a267a595c1 | Open Energy Information  

Open Energy Info (EERE)

0a82f-3ccb-4ce5-b6dc-12a267a595c1 0a82f-3ccb-4ce5-b6dc-12a267a595c1 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Wahoo, Nebraska (Utility Company) Effective date: 2012/02/01 End date if known: Rate name: Industrial Large General Service (Three Phase) Sector: Industrial Description: Source or reference: http://www.wahoo.ne.us/content_subcat.asp?SubCategoryID=88&CategoryID=125&ContentID=68 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V):


Data:5820ba98-12a4-4dd7-a83b-c3350ad462a2 | Open Energy Information  

Open Energy Info (EERE)

ba98-12a4-4dd7-a83b-c3350ad462a2 ba98-12a4-4dd7-a83b-c3350ad462a2 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Orange & Rockland Utils Inc Effective date: 2012/04/01 End date if known: Rate name: SC16 Street Lighting Induction Overhead and Underground 70w (Customer owned, retail service, multiple bills) Sector: Description: APPLICABLE TO USE OF SERVICE FOR: Sales and delivery of electric power supply provided by the Company or delivery of electric power supply provided by an Energy Service Company under the Company's Retail Access Program for outdoor lighting of areas, beyond the limits of public streets, highways or roadways, for use of individuals and private or public organizations where existing distribution facilities are suitable for the service requested.


Data:420fb714-7054-49c9-8b1f-f07dac56b12a | Open Energy Information  

Open Energy Info (EERE)

14-7054-49c9-8b1f-f07dac56b12a 14-7054-49c9-8b1f-f07dac56b12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: KEM Electric Coop Inc Effective date: End date if known: Rate name: Electric Heat Service -7 M Sector: Residential Description: Available to all members under SE-1, where electric heat is the primary source of heating. Service shall be to a single point of service Type of Service Single Phase, 60 cycle, at secondary voltages. The Cooperative will provide meter, meter socket, and C.T. equipment necessary to measure electric usage. Source or reference: http://www.kemelectric.com/Customer_Service/Rate_Schedules/Schedule%20EH-7M/index.html


Data:De12a8fe-13b5-4491-9139-ea729b96ec3d | Open Energy Information  

Open Energy Info (EERE)

De12a8fe-13b5-4491-9139-ea729b96ec3d De12a8fe-13b5-4491-9139-ea729b96ec3d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Seattle, Washington (Utility Company) Effective date: 2012/01/01 End date if known: Rate name: Schedule LGB-Large Standard General Service:Burien(First Avenue South 1 Undergrounding Charge) Sector: Commercial Description: SCHEDULE LGS is for standard general service provided to Burien customers whose maximum monthly demand is equal to or greater than 1,000 kW but less than 10,000 kW. Minimum Charge: $34.21 per meter per day. First Avenue South 1 Undergrounding Charge: All kWh at 0.37 cent per kWh


Data:Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a | Open Energy Information  

Open Energy Info (EERE)

Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a Eabd2142-fc95-40fa-b50c-1ac0c9a2d12a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Painesville, Ohio (Utility Company) Effective date: 1990/07/01 End date if known: Rate name: Intersection flasher light-Within Corporate Limits Sector: Lighting Description: For the purpose of paying the expenses of conducting and managing the Electric Division, Utilities Department, of the City, the City Manager is hereby authorized and directed to charge the following rates, for all utility bills issued on and after the dates indicated below. These rates are applicable to service calls, unmetered services, standby power and miscellaneous installations which do not fall under the normal rate schedules, which rates are hereby adopted for all utility bills issued on and after July 1, 1990


Data:4f82f0e5-12a3-453d-9fbf-d3583d8e7236 | Open Energy Information  

Open Energy Info (EERE)

2f0e5-12a3-453d-9fbf-d3583d8e7236 2f0e5-12a3-453d-9fbf-d3583d8e7236 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Provo City Corp (Utility Company) Effective date: 2012/06/01 End date if known: Rate name: Private Outdoor Security (Closed Rate) - 250 W MV - Wood Pole Sector: Lighting Description: Source or reference: http://www.provo.org/util.rates_summary.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:


Data:6f693279-9c83-43fc-8432-a0927c12a5f9 | Open Energy Information  

Open Energy Info (EERE)

9-9c83-43fc-8432-a0927c12a5f9 9-9c83-43fc-8432-a0927c12a5f9 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Kiel, Wisconsin (Utility Company) Effective date: 2011/05/06 End date if known: Rate name: Cp-3 Industrial Power Time-of-Day Service above 600kW Demand 8am-10pm Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0754 per kilowatt-hour.


Data:7fb75ac1-2a7e-4b4a-b21e-c51764137a9e | Open Energy Information  

Open Energy Info (EERE)

7fb75ac1-2a7e-4b4a-b21e-c51764137a9e 7fb75ac1-2a7e-4b4a-b21e-c51764137a9e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: New York Power Authority Effective date: 2013/07/01 End date if known: Rate name: SC 68 Conventional (Westchester Customers) Sector: Commercial Description: Source or reference: http://www.nypa.gov/about/documents.htm Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>


Data:19280696-9d1c-44f3-a80a-12a25ad40f31 | Open Energy Information  

Open Energy Info (EERE)

696-9d1c-44f3-a80a-12a25ad40f31 696-9d1c-44f3-a80a-12a25ad40f31 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Orange & Rockland Utils Inc Effective date: 2012/04/01 End date if known: Rate name: SC16 Street Lighting Induction Overhead and Underground 150w (Customer owned, full service, single bill) Sector: Description: APPLICABLE TO USE OF SERVICE FOR: Sales and delivery of electric power supply provided by the Company or delivery of electric power supply provided by an Energy Service Company under the Company's Retail Access Program for outdoor lighting of areas, beyond the limits of public streets, highways or roadways, for use of individuals and private or public organizations where existing distribution facilities are suitable for the service requested.


R{sub 4}Ir{sub 13}Ge{sub 9} (R=La, Ce, Pr, Nd, Sm) and RIr{sub 3}Ge{sub 2} (R=La, Ce, Pr, Nd): Crystal structures with nets of Ir atoms  

Science Conference Proceedings (OSTI)

The crystal structures of the new ternary compounds Sm{sub 4}Ir{sub 13}Ge{sub 9} and LaIr{sub 3}Ge{sub 2} were determined and refined on the basis of single-crystal X-ray diffraction data. They belong to the Ho{sub 4}Ir{sub 13}Ge{sub 9} (oP52, Pmmn) and CeCo{sub 3}B{sub 2} (hP5, P6/mmm) structure types, respectively. The formation of isotypic compounds R{sub 4}Ir{sub 13}Ge{sub 9} with R=La, Ce, Pr, Nd, and RIr{sub 3}Ge{sub 2} with R=Ce, Pr, Nd, was established by powder X-ray diffraction. The RIr{sub 3}Ge{sub 2} (R=La, Ce, Pr, Nd) compounds exist only in as-cast samples and decompose during annealing at 800 Degree-Sign C with the formation of R{sub 4}Ir{sub 13}Ge{sub 9}. The structure of Sm{sub 4}Ir{sub 13}Ge{sub 9} contains intersecting, slightly puckered nets of Ir atoms (4{sup 4})(4{sup 3}.6){sub 2}(4.6{sup 2}){sub 2} and (4{sup 4}){sub 2}(4{sup 3}.6){sub 4}(4.6{sup 2}){sub 2} that are perpendicular to [0 1 1] as well as to [0 -1 1] and [0 0 1]. The Ir atoms are surrounded by Ge atoms that form tetrahedra or square pyramids (where the layers intersect). The Sm and additional Ir atoms (in trigonal-planar coordination) are situated in channels along [1 0 0] (short translation vector). In the structure of LaIr{sub 3}Ge{sub 2} the Ir atoms form planar Kagome nets ( perpendicular to [0 0 1]. These nets alternate along the short translation vector with layers of La and Ge atoms. - Graphical abstract: The crystal structures contain the nets of Ir atoms as main structural motif: R{sub 4}Ir{sub 13}Ge{sub 9} contains intersecting slightly puckered nets of Ir atoms, whereas in the structure of RIr{sub 3}Ge{sub 2} the Ir atoms form planar Kagome nets. Highlights: Black-Right-Pointing-Pointer The Ir-rich ternary germanides R{sub 4}Ir{sub 13}Ge{sub 9} (R=La, Ce, Pr, Nd, Sm) and RIr{sub 3}Ge{sub 2} (R=La, Ce, Pr, Nd) have been synthesized. Black-Right-Pointing-Pointer The RIr{sub 3}Ge{sub 2} compounds exist only in as-cast samples and decompose during annealing at 800 Degree-Sign C with the formation of R{sub 4}Ir{sub 13}Ge{sub 9}. Black-Right-Pointing-Pointer The structure of R{sub 4}Ir{sub 13}Ge{sub 9} contains intersecting slightly puckered nets of Ir atoms. Black-Right-Pointing-Pointer In the structure of RIr{sub 3}Ge{sub 2} the Ir atoms form planar Kagome nets.

Yarema, Maksym [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Kyryla i Mefodiya Str, 6, UA-79005 Lviv (Ukraine) [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Kyryla i Mefodiya Str, 6, UA-79005 Lviv (Ukraine); Swiss Federal Laboratories for Materials Science and Technology (EMPA), Ueberlandstr. 129, CH-8600 Duebendorf (Switzerland); Zaremba, Oksana; Gladyshevskii, Roman [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Kyryla i Mefodiya Str, 6, UA-79005 Lviv (Ukraine)] [Department of Inorganic Chemistry, Ivan Franko National University of Lviv, Kyryla i Mefodiya Str, 6, UA-79005 Lviv (Ukraine); Hlukhyy, Viktor, E-mail: viktor.hlukhyy@lrz.tu-muenchen.de [Department Chemie, Technische Universitaet Muenchen, Lichtenbergstr. 4, D-85747 Garching (Germany)] [Department Chemie, Technische Universitaet Muenchen, Lichtenbergstr. 4, D-85747 Garching (Germany); Faessler, Thomas F. [Department Chemie, Technische Universitaet Muenchen, Lichtenbergstr. 4, D-85747 Garching (Germany)] [Department Chemie, Technische Universitaet Muenchen, Lichtenbergstr. 4, D-85747 Garching (Germany)



Data:Cb684dd4-12a1-4e54-928a-bf6281e7b00e | Open Energy Information  

Open Energy Info (EERE)

Data Data Edit with form History Facebook icon Twitter icon » Data:Cb684dd4-12a1-4e54-928a-bf6281e7b00e No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Sulphur Springs Valley E C Inc Effective date: 2013/03/18 End date if known: Rate name: Street Lighting: 250 Watt MV - Double/Wood Sector: Lighting Description: Customer provided Facilities and Cooperative Owned and Maintained Lighting Service. Source or reference: http://www.ssvec.org/wp-content/uploads/downloads/2013/03/SSVEC-Rates-03.18.13.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW):


Data:E72ee42e-a63e-4795-9893-3ef12a88bed0 | Open Energy Information  

Open Energy Info (EERE)

ee42e-a63e-4795-9893-3ef12a88bed0 ee42e-a63e-4795-9893-3ef12a88bed0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Idaho Power Co Effective date: 2008/03/01 End date if known: Rate name: Schedule 62 - Green energy Purchase Program Rider Sector: Description: PURPOSE The Green Energy Purchase Program is an optional, voluntary program designed to provide customers and non-customer participants an opportunity to participate in the purchase of new environmentally friendly "green" energy. Funds collected in this program will be wholly distributed to the purchase of green energy products. APPLICABILITY Service under this schedule is applicable to all Customers and non-customer participants who choose to participate in this Program. MONTHLY GREEN ENERGY PURCHASE CONTRIBUTION Customers designate their level of participation by choosing a fixed dollar per month amount. The monthly Green Energy Purchase Program contribution is in addition to all other charges included in the service schedule under which the Customer receives electrical service and will be added to the Customer's monthly electric bill. Non-Customer participants will be issued a monthly invoice that reflects their designated fixed dollar per month amount. The Program funds will wholly be used to purchase green energy or cover the green energy price premium. PROGRAM CONSIDERATIONS No electric service disconnections will result in the event of non-payment of Program commitments.


Data:E2d97b12-a1ba-4919-b041-0ce6b9bc25dd | Open Energy Information  

Open Energy Info (EERE)

7b12-a1ba-4919-b041-0ce6b9bc25dd 7b12-a1ba-4919-b041-0ce6b9bc25dd No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northern States Power Co - Wisconsin Effective date: 2012/01/15 End date if known: Rate name: Experimental Advanced Renewable Energy Purchase Service Solar Energy Systems 10 kW (at more than 200 amps) Sector: Description: Effective In All territories served by the Company. Definition: Distributed generation facilities are electricity generators owned by the customer, located R close to the point of energy consumption, and small in scale, usually no more than the existing load of the customer. Availability The advanced renewable energy tariff is available to retail customers who own small distributed generation facilities that are powered by a renewable resource and placed in initial service after January 1, 2012, or who executed an advanced renewable energy contract prior to January 1, 2012. aximum size project per customer is: Solar: 10 kW Technology Limit The solar technology category will be fully subscribed when 300 kW of capacity has been subscribed. Community-based Limits The Community-based Project Category is only applicable to the Biomass/Biogas and Wind technology categories and will be fully subscribed when 5 MW of capacity has been subscribed. In addition, the Community-based Category is applicable only to projects owned by local units of government (Village, City, Town or County), or to projects majority-owned by existing retail customers that choose to join together to develop a joint project. The customer will receive a $1.50/watt capital incentive payment up to a total of $15,000 per facility.


CeLAND: search for a 4th light neutrino state with a 3 PBq 144Ce-144Pr electron antineutrino generator in KamLAND  

E-Print Network (OSTI)

The reactor neutrino and gallium anomalies can be tested with a 3-4 PBq (75-100 kCi scale) 144Ce-144Pr antineutrino beta-source deployed at the center or next to a large low-background liquid scintillator detector. The antineutrino generator will be produced by the Russian reprocessing plant PA Mayak as early as 2014, transported to Japan, and deployed in the Kamioka Liquid Scintillator Anti-Neutrino Detector (KamLAND) as early as 2015. KamLAND's 13 m diameter target volume provides a suitable environment to measure the energy and position dependence of the detected neutrino flux. A characteristic oscillation pattern would be visible for a baseline of about 10 m or less, providing a very clean signal of neutrino disappearance into a yet-unknown, sterile neutrino state. This will provide a comprehensive test of the electron dissaperance neutrino anomalies and could lead to the discovery of a 4th neutrino state for Delta_m^2 > 0.1 eV^2 and sin^2(2theta) > 0.05.

A. Gando; Y. Gando; S. Hayashida; H. Ikeda; K. Inoue; K. Ishidoshiro; H. Ishikawa; M. Koga; R. Matsuda; S. Matsuda; T. Mitsui; D. Motoki; K. Nakamura; Y. Oki; M. Otani; I. Shimizu; J. Shirai; F. Suekane; A. Suzuki; Y. Takemoto; K. Tamae; K. Ueshima; H. Watanabe; B. D. Xu; S. Yamada; Y. Yamauchi; H. Yoshida; M. Cribier; M. Durero; V. Fischer; J. Gaffiot; N. Jonqueres; A. Kouchner; T. Lasserre; D. Leterme; A. Letourneau; D. Lhuillier; G. Mention; G. Rampal; L. Scola; Ch. Veyssiere; M. Vivier; P. Yala; B. E. Berger; A. Kozlov; T. Banks; D. Dwyer; B. K. Fujikawa; K. Han; Yu. G. Kolomensky; Y. Mei; T. O'Donnell; P. Decowski; D. M. Markoff; S. Yoshida; V. N. Kornoukhov; T. V. M. Gelis; G. V. Tikhomirov; J. G. Learned; J. Maricic; S. Matsuno; R. Milincic; H. J. Karwowski; Y. Efremenko; A. Detwiler; S. Enomoto



Pr{sub 0.67}Ba{sub 0.33}MnO{sub 3} in Bulk and Thin Film Ceramic  

Science Conference Proceedings (OSTI)

Bulk polycrystalline of Pr{sub 0.67}Ba{sub 0.33}MnO{sub 3}(PBMO) ceramic prepared via solid-state reaction and converted into thin films on corning glass, fused silica and MgO (100) by pulsed laser deposition (PLD) technique. As compared to bulk PBMO, the unit cell in thin film PBMO experienced positive misfit due to lattice strain induced by substrate used resulting MnO{sub 6} to deform (change in Mn-O-Mn bond angle and Mn-O bond length). Bulk PBMO had large grains ({approx}1.5{mu}m) as compared to thin film which are nano-sized (<100 nm). Two metal-insulator transition temperatures, T{sub P}(156 K and 190 K) were observed in bulk due to core-shell effect as proposed by Zhang et al.. In summary, variation of electrical behaviour was observed between bulk and thin film samples which believed to be due to the difference of ordering in core (body) and grain surface.

Wong, J. K.; Lim, K. P.; Halim, S. A.; Chen, S. K.; Ng, S. W.; Gan, H. M. Albert [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor (Malaysia)



Softening and Broadening of the Zone Boundary Magnons in Pr0.63Sr0.37MnO3  

E-Print Network (OSTI)

We have studied the spin dynamics in Pr0.63Sr0.37MnO3 above and below the Curie temperature TC = 301 K. Three distinct new features have been observed: a softening of the magnon dispersion at the zone boundary for T < TC, significant broadening of the zone boundary magnons as T ? TC, and no evidence for residual spin-wave like excitations just above TC. The results are inconsistent with double exchange models that have been successfully applied to higher TC samples, indicating an evolution of the spin system with decreasing TC. Typeset using REVTEX 1 The revival in the study of manganites has led to a reexamination of the unique coupling between magnetism and charge transport in these materials. We focus on perovskite manganites with a transition from a high temperature paramagnetic insulator to a low temperature ferromagnetic metal at the Curie temperature TC. The samples that exhibit this behavior have been partially hole doped away from a parent antiferromagnetic insulator,

H. Y. Hwang; P. Dai; S-w. Cheong; D. A. Tennant; H. A. Mook



EU promises new biofuel rules won't harm the environment http://www.pr-inside.com/eu-promises-new-biofuel-rules-won-t-r385258.htm 1 of 2 1/16/2008 12:32 PM  

E-Print Network (OSTI)

of the Earth Europe on Monday called for the EU to step away from its 10 percent biofuel target unless it couldEU promises new biofuel rules won't harm the environment http://www.pr-inside.com/eu-promises-new-biofuel promises new biofuel rules won't harm the environment © AP 2008-01-14 16:21:49 - BRUSSELS, Belgium (AP


Reply to Comment on X-ray resonant scattering studies of orbital and charge ordering in Pr[sub 1-x]Ca[sub x]MnO[sub 3].  

SciTech Connect

The interpretation given in our recent x-ray scattering study of Pr{sub 1-x}Ca{sub x}MnO{sub 3} in terms of charge and orbital ordering is questioned in the preceding Comment by Garcia and Subias. They argue that anisotropy of the charge distribution induced by local distortions gives rise to the so-called charge order reflections. In this Reply we suggest that the two different pictures are reconcilable.

Zimmermann, M. V.; Grenier, S.; Nelson, C. S.; Hill, J. P.; Gibbs, D.; Blume, M.; Casa, D.; Keimer, B.; Murakami, Y.; Kao, C.-C.; Venkataraman, C.; Gog, T.; Tomioka, Y.; Tokura, Y.; HASYLAB, DESY; BNL; Rutgers Univ.; Max-Planck-Institut; Tohoku Univ.; NSLS; JRCAT; Univ. of Tokyo


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Thermally stable compositions including 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt  

DOE Patents (OSTI)

An explosive formulation including 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt and a high temperature binder is disclosed together with a process of preparing 2,4,8,10-tetranitro-5H-pyrido[3',2':4,5][1,2,3]triazolo[1,2-a]benzotriazo- l-6-ium, inner salt.

Hiskey, Michael A. (Los Alamos, NM); Huynh, My Hang (Los Alamos, NM)



Correlation between electrical properties and thermodynamic stability of ACoO{sub 3-{delta}} perovskites (A= La, Pr, Nd, Sm, Gd)  

SciTech Connect

For perovskites with the general formula ACoO{sub 3-{delta}} (A = La, Pr, Nd, Sm, and Gd) the influence of the A-site cation on the electrical conductivity, electronic structure, thermodynamic stability, and oxygen stoichiometry was studied. The perovskite oxide powders were produced by a combined citric acid and ethylenediaminetetraacetic acid complexing method. Ceramic specimens sintered at 1100 deg. C in air were single-phase perovskites. With increasing temperature, the electrical conductivity shows three discrete regimes. All compositions show semiconductivity up to a transition temperature of {approx}300 deg. C-450 deg. C and then behave like metallic conductors. The activation energies for the semiconductivity, as well as the transition temperatures to the metallic-like conduction, decrease monotonically with increasing pseudocubic lattice parameters, i.e., with increasing ionic radii of the A cation. This behavior correlates with decreasing oxygen nonstoichiometry and increased thermodynamic stability. The highest conductivity and the lowest activation energy of 0.66 eV were found for LaCoO{sub 3-{delta},} which also had the lowest semiconductor-metal transition temperature at 269 deg. C, the lowest oxygen nonstoichiometry of {delta}= 0.008, and the highest Gibbs free energy change for the decomposition reaction of 42.37 kJ/mol at 850 deg. C. GdCoO{sub 3-{delta}} had the highest oxygen nonstoichiometry with {delta}0.032, a high activation energy of 1.19 eV for the semiconductivity with a high transition temperature at 452 deg. C, and the lowest Gibbs free energy change of 26.54 kJ/mol at 850 deg. C. X-ray absorption spectroscopy data imply an increasing Co low-spin character with decreasing cation radius from La to Gd, while an increase in temperature increases the number of holes or Co 3d bandwidth. This correlates well with the electrical conductivity data.

Scherrer, Barbara; Harvey, Ashley S.; Martynczuk, Julia; Gauckler, Ludwig J. [Department of Materials, ETH Zurich, Wolfgang-Pauli-Str. 10, 8093 Zurich (Switzerland); Tanasescu, Speranta; Teodorescu, Florina; Botea, Alina [Institute of Physical Chemistry ''Ilie Murgulescu,'' Splaiul Independentei 202, 060021 Bucharest (Romania); Conder, Kazimierz [Laboratory for Developments and Methods, Paul Scherrer Institut, 5232 Villigen-PSI (Switzerland); Grundy, A. Nicholas [Department of Materials, ETH Zurich, Wolfgang-Pauli-Str. 10, 8093 Zurich (Switzerland); CONCAST AG, Toedistrasse 9, 8027 Zurich (Switzerland)




NLE Websites -- All DOE Office Websites (Extended Search)

using their MesoMap system and historical weather data under contract to Wind Powering AmericaNREL. This map has been validated with available surface data by NREL and...



E-Print Network (OSTI)

weather and monitoring the space environment. For example, type-III solar radio bursts are producedLANGMUIR TURBULENCE AND SOLAR RADIO BURSTS F. B. RIZZATO1,2, A. C.-L. CHIAN2,3, M. V. ALVES3, R beam-plasma instability play a fundamental role in the generation of solar radio bursts. We report


Undirectional Diagonal Order and Three-Dimensional Stacking of Charge Stripes in Orthorhombic Pr1.67Sr0.33NiO4 and Nd1.67Sr0.33NiO4  

SciTech Connect

The interplay between crystal symmetry and charge stripe order in Pr{sub 1.67}Sr{sub 0.33}NiO{sub 4} and Nd{sub 1.67}Sr{sub 0.33}NiO{sub 4} has been studied by means of single crystal x-ray diffraction. In contrast to tetragonal La{sub 1.67}Sr{sub 0.33}NiO{sub 4}, these crystals are orthorhombic. The corresponding distortion of the NiO{sub 2} planes is found to dictate the direction of the charge stripes, similar to the case of diagonal spin stripes in the insulating phase of La{sub 2-x}Sr{sub x}CuO{sub 4}. In particular, diagonal stripes seem to always run along the short a axis, which is the direction of the octahedral tilt axis. In contrast, no influence of the crystal symmetry on the charge stripe ordering temperature itself was observed, with T{sub CO}{approx}240 K for La, Pr, and Nd. The coupling between lattice and stripe degrees of freedom allows one to produce macroscopic samples with unidirectional stripe order. In samples with stoichiometric oxygen content and a hole concentration of exactly 1/3, charge stripes exhibit a staggered stacking order with a period of three NiO{sub 2} layers, previously only observed with electron microscopy in domains of mesoscopic dimensions. Remarkably, this stacking order starts to melt about 40 K below T{sub CO}. The melting process can be described by mixing the ground state, which has a three-layer stacking period, with an increasing volume fraction with a two-layer stacking period.

Hucker,M.; Zimmermann, M.; Klingelar, R.; Kiele, S.; Geck, J.; Bakehe, S.; Zhang, J.; Hill, J.; Revcolevschi, A.; et al.



OOMMF 1.2a3 Patches  

Science Conference Proceedings (OSTI)

... (Thanks to RP Boardman for reporting this.) Solution: Apply this patch, and if you haven't already, also the the patch at item 3, and rerun pimake. ...



NEPA Determination: LM-12a-12  

Energy.gov (U.S. Department of Energy (DOE))

Additional Considerations Amendment to LM #12-12, Routine and Non-Routine Activities at the Grand Junction, Colorado, Office Site


Data:Ea6a12a3-4a11-4d01-8ca1-0be1b3e38aeb | Open Energy Information  

Open Energy Info (EERE)

a12a3-4a11-4d01-8ca1-0be1b3e38aeb a12a3-4a11-4d01-8ca1-0be1b3e38aeb No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northern Plains Electric Coop Effective date: 2012/02/01 End date if known: Rate name: SMALL RENEWABLE ENERGY PURCHASE RATE Sector: Description: Availability This rate is applicable for a member-owned renewable energy generating facility with a capacity less than 150 KW which is properly interconnected to the Northern Plains Electric Cooperative electrical system (Qualifying Facility) and which the generated power is sold to Northern Plains. Type of Service Single or three phase, 60 hertz, at available primary or secondary voltages.


Data:04c64d7f-c7c7-43f6-aca1-2a7ab06dd02d | Open Energy Information  

Open Energy Info (EERE)

4d7f-c7c7-43f6-aca1-2a7ab06dd02d 4d7f-c7c7-43f6-aca1-2a7ab06dd02d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Delta Montrose Electric Assn Effective date: 2012/01/01 End date if known: Rate name: LARGE COMMERCIAL NET METERING Sector: Commercial Description: Source or reference: http://www.dmea.com/index.php?option=com_content&view=article&id=95&Itemid=72 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:


Data:F157faf1-12a5-4c9e-84de-b1ea0d72e277 | Open Energy Information  

Open Energy Info (EERE)

F157faf1-12a5-4c9e-84de-b1ea0d72e277 F157faf1-12a5-4c9e-84de-b1ea0d72e277 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: South Central Indiana REMC Effective date: 2010/06/01 End date if known: Rate name: Residential & Farm Rate - RS - HP Sector: Residential Description: Availability Available as an optional rate to any residential or farm consumer of the Corporation for singlephase electric service at a single delivery point who has an air source heat pump with natural gas or LP gas backup. The air source heat pump system must not have any auxiliary emergency resistance heat installed. A representative of the Corporation must certify the air source heat pump as meeting the requirements of this rate schedule. A Demand Response Unit (DRU) must be installed that allows for control of the air conditioning load during peak periods as determined by the Corporation. The rated capacity of any motor served under this schedule in excess of ten (10) horsepower shall be subject to the approval of the Corporation. A consumer choosing this optional rate must remain on the rate for a minimum of six months. Consumers opting to change to a different rate schedule after the six month minimum period must wait a minimum of six months before returning to this optional rate.



NLE Websites -- All DOE Office Websites (Extended Search)

Mass Spectrometry (AMS) Mass Spectrometry (AMS) at ATLAS Walter Kutschera Vienna Environmental Research Accelerator (VERA) Fakultät für Physik, Universität Wien, Austria ATLAS 25 th Anniversary Celebration Physics Division, Argonne National Laboratory 22-23 October 2010 AMS at ATLAS over the years Year Radioisotope Accelerator Topic 1979 14 C, 26 Al, 32 Si, 36 Cl Tandem Detection with split-pole spectrograph 1980 32 Si Tandem Half-life measurement (101 yr) 1980 26 Al Tandem Cross section 26 Mg(p,γ) 26 Al 1983 44 Ti Tandem Half-life measurement (54 yr) 1984 B - - , C - - , O - - Tandem No evidence found ( <10 -15 ) 1984 60 Fe Tandem+Linac Half-life measurement (1.5x10 6 yr) 1984 Free quarks Injector Fermi Lab Cryogenic search for free quarks 1987 41 Ca Tandem+Linac+GFM Developing a 41 Ca dating method 1993 59 Ni Tandem+Linac+FS Solar CR alphas


Présentation PowerPoint  

NLE Websites -- All DOE Office Websites (Extended Search)

Sulfur Sulfur Electrolyzer Workshop - 20-21 April 2009 - 1 DEN/DANS/DPC/SCCME Characterization and optimization of materials for hybrid sulfur cycle electrolyser CEA Saclay R. Robin, N. Gruet Laboratory of Non Aqueous Corrosion DEN/DPC/SCCME Hybrid Sulfur Electrolyzer Workshop - 20-21 April 2009 - 2 DEN/DANS/DPC/SCCME Hybrid Sulfur Cycle Electrolyser - Schematic Diagram Electrochemical Step Electrochemical Step Oxidation of SO 2 and Reduction of proton SO 2 + 2 H H 2 2 O O → H H 2 2 + H 2 SO 4 Recycling Intermediate H 2 SO 4 SO 2 H 2 O O 2 SO 3 HTR H 2 H 2 O 900°C 100°C 600°C Thermochemical Thermochemical Step Step Thermal decomposition of H 2 SO 4 H 2 2 SO 4 4 → SO 3 3 + H 2 2 O SO 2 2 + ½ O O 2 2 Hybrid Sulfur Electrolyzer Workshop - 20-21 April 2009 - 3 DEN/DANS/DPC/SCCME Hybrid Sulfur Cycle Electrolyzer - Objective Main objective of the study


Microsoft Word - PR-10085844 NEPA.docx  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

5844 5844 Title: Replace BC 500 KVA Power Transformer Description: Subcontractor shall provide all labor, supervision, tools, equipment, and transportation required to procure, transport, install, test and pre-commission the new BC 500 KVA power transformer, SDTFW and new switch assembly. Work includes transportation of the transformer and switch assembly from the manufacturer's plant to BC; removal of existing equipment; unloading, assembly and installation of new equipment; and pre-commission testing. Subcontractor shall provide the lifting equipment required to remove the existing transformer and switch assembly, and to install the new equipment. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions)


Présentation PowerPoint  

NLE Websites -- All DOE Office Websites (Extended Search)

Cirrus cloud Cirrus cloud radiative radiative forcing forcing Cirrus cloud Cirrus cloud radiative radiative forcing forcing on surface on surface - - level shortwave and level shortwave and longwave longwave irradiances irradiances at regional and global scale at regional and global scale M. Haeffelin 1 , J-C. Dupont 1 , C. Long 2 1 Institut Pierre et Simon Laplace, Ecole Polytechnique/CNRS, France 2 Pacific Northwest National Laboratory, Richland WA, USA The authors acknowledge the US ARM program, the IPSL observatories and the NASA/CNES CALIPSO and NASA/AIRS programs for providing the data used in this study. We thank the Centre National d'Etudes Spatiales (CNES) and Centre National de la Recherche Scientifique (CNRS) for their support in this study. 19th ARM Science Team Meeting 1 Apr 2009 0 25 50 75 (%) Stubenrauch et al. (2006)



NLE Websites -- All DOE Office Websites (Extended Search)

Instrument Retrievals: Applications and New Synergies Instrument Retrievals: Applications and New Synergies Can we derive LWC profiles from MWRs ? U. Löhnert 1 , S. Crewell 1 , K. Ebell 1 , D. Turner 2 1 University of Cologne, Germany 2 University of Wisconsin-Madison, Madison, Wisconsin RHUBC-I, Alaska, 2007 ARM Science Team Meeting, 30 March -2 April 2009, Louisville, KY Summary "New" Synergies - Microwave & Infrared Method for combining measurements Acknowledgements: We thank the ARM Program and the German Science Foundation (DFG) for their support. * IPT (1DVar retrieval approach) applied to AMF-COPS dataset to retrieve temperature, humidity and LWC profiles from a combined a suite of sensors. * IPT results and errors are used to estimate SW/LW fluxes and their corresponding errors. * AERI retrievals of clear-sky temperature and humidity profiles outperform


References and Notes for Praseodymium ( Pr )  

Science Conference Proceedings (OSTI)

... G90, A. Ginbre, At. Data Nucl. Data Tables 44, 1 (1990). GKQW91, A. Goly, J. Kusz, B. Nguyen Quang, and S. Weniger, J. Quant. Spectrosc. Radiat. ...


Team PrISUm Evan Stumpges  

E-Print Network (OSTI)

in order to use it in the manufacturing of the windshield by Grimm Brothers Plastic. In addition body, and to the Delta Airlines facility in Minneapolis, MN where they used the molds to manufacture finalizing the design and beginning manufacturing for the new car. However, we have a busy semester ahead

Beresnev, Igor


pr esent ee par Cordelia SCHMID  

E-Print Network (OSTI)

caract erise un point localement. Cette information est calcul ee aux points d'int er^etet stock eedans

Paris-Sud XI, Université de


pr esent ee par Cordelia SCHMID  

E-Print Network (OSTI)

calcul ee aux points d'int er^etet stock eedans des vecteurs cf. gure 1.1.Elle permet de caract eriser

Verbeek, Jakob



U.S. Energy Information Administration (EIA) Indexed Site

100,000 MMCF > 100,000 MMCF Basin Outline Powder River Basin WY MT CO SD NE ND 1 2 Index Map for 2 Powder River Basin Panels 2001 Reserve Summary for All Powder River Basin Fields...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



U.S. Energy Information Administration (EIA) Indexed Site

Mbbl 10,000.1 - 100,000 Mbbl Basin Outline Powder River Basin WY MT CO SD NE ND 1 2 Index Map for 2 Powder River Basin Panels 2001 Reserve Summary for All Powder River Basin Fields...



U.S. Energy Information Administration (EIA) Indexed Site

100,000 MBOE > 100,000 MBOE Basin Outline Powder River Basin WY MT CO SD NE ND 1 2 Index Map for 2 Powder River Basin Panels 2001 Reserve Summary for All Powder River Basin Fields...


Plasma-enhanced and thermal atomic layer deposition of Al{sub 2}O{sub 3} using dimethylaluminum isopropoxide, [Al(CH{sub 3}){sub 2}({mu}-O{sup i}Pr)]{sub 2}, as an alternative aluminum precursor  

Science Conference Proceedings (OSTI)

The authors have been investigating the use of [Al(CH{sub 3}){sub 2}({mu}-O{sup i}Pr)]{sub 2} (DMAI) as an alternative Al precursor to [Al(CH{sub 3}){sub 3}] (TMA) for remote plasma-enhanced and thermal ALD over wide temperature ranges of 25-400 and 100-400 deg. C, respectively. The growth per cycle (GPC) obtained using in situ spectroscopic ellipsometry for plasma-enhanced ALD was 0.7-0.9 A/cycle, generally lower than the >0.9 A/cycle afforded by TMA. In contrast, the thermal process gave a higher GPC than TMA above 250 deg. C, but below this temperature, the GPC decreased rapidly with decreasing temperature. Quadrupole mass spectrometry data confirmed that both CH{sub 4} and HO{sup i}Pr were formed during the DMAI dose for both the plasma-enhanced and thermal processes. CH{sub 4} and HO{sup i}Pr were also formed during the H{sub 2}O dose but combustion-like products (CO{sub 2} and H{sub 2}O) were observed during the O{sub 2} plasma dose. Rutherford backscattering spectrometry showed that, for temperatures >100 deg. C and >200 deg. C for plasma-enhanced and thermal ALD, respectively, films from DMAI had an O/Al ratio of 1.5-1.6, a H content of {approx}5 at. % and mass densities of 2.7-3.0 g cm{sup -3}. The film compositions afforded from DMAI were comparable to those from TMA at deposition temperatures {>=}150 deg. C At lower temperatures, there were differences in O, H, and C incorporation. 30 nm thick Al{sub 2}O{sub 3} films from the plasma-enhanced ALD of DMAI were found to passivate n- and p-type Si floatzone wafers ({approx}3.5 and {approx}2 {Omega} cm, respectively) with effective carrier lifetimes comparable to those obtained using TMA. Surface recombination velocities of < 3 and < 6 cm s{sup -1} were obtained for the n- and p-type Si, respectively. Using these results, the film properties obtained using DMAI and TMA are compared and the mechanisms for the plasma-enhanced and thermal ALD using DMAI are discussed.

Potts, Stephen E.; Dingemans, Gijs; Lachaud, Christophe; Kessels, W. M. M. [Department of Applied Physics, Eindhoven University of Technology, P. O. Box 513, 5600 MB Eindhoven (Netherlands); Air Liquide Research and Development, 1 Chemin de la Porte des Loges, BP 126, 78345 Jouy-en-Josas (France); Department of Applied Physics, Eindhoven University of Technology, P. O. Box 513, 5600 MB Eindhoven (Netherlands)



Unidirectional diagonal order and three-dimensional stacking of charge stripes in orthorhombic Pr{sub 1.67}Sr{sub 0.33}NiO{sub 4} and Nd{sub 1.67}Sr{sub 0.33}NiO{sub 4}  

Science Conference Proceedings (OSTI)

The interplay between crystal symmetry and charge stripe order in Pr{sub 1.67}Sr{sub 0.33}NiO{sub 4} and Nd{sub 1.67}Sr{sub 0.33}NiO{sub 4} has been studied by means of single crystal x-ray diffraction. In contrast to tetragonal La{sub 1.67}Sr{sub 0.33}NiO{sub 4}, these crystals are orthorhombic. The corresponding distortion of the NiO{sub 2} planes is found to dictate the direction of the charge stripes, similar to the case of diagonal spin stripes in the insulating phase of La{sub 2-x}Sr{sub x}CuO{sub 4}. In particular, diagonal stripes seem to always run along the short a axis, which is the direction of the octahedral tilt axis. In contrast, no influence of the crystal symmetry on the charge stripe ordering temperature itself was observed, with T{sub CO}{approx}240 K for La, Pr, and Nd. The coupling between lattice and stripe degrees of freedom allows one to produce macroscopic samples with unidirectional stripe order. In samples with stoichiometric oxygen content and a hole concentration of exactly 1/3, charge stripes exhibit a staggered stacking order with a period of three NiO{sub 2} layers, previously only observed with electron microscopy in domains of mesoscopic dimensions. Remarkably, this stacking order starts to melt about 40 K below T{sub CO}. The melting process can be described by mixing the ground state, which has a three-layer stacking period, with an increasing volume fraction with a two-layer stacking period.

Huecker, M.; Hill, J. P.; Tranquada, J. M. [Condensed Matter Physics and Materials Science Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Zimmermann, M. v. [Hamburger Synchrotronstrahlungslabor HASYLAB at Deutsches Elektronen-Synchrotron, 22603 Hamburg (Germany); Klingeler, R.; Kiele, S.; Geck, J.; Buechner, B. [Leibniz-Institute for Solid State and Materials Research IFW Dresden, 01171 Dresden (Germany); Bakehe, S. N. [II. Physikalisches Institut, Universitaet zu Koeln, 50937 Koeln (Germany); Zhang, J. Z. [Condensed Matter Physics and Materials Science Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Cornell University, Ithaca, New York 14850 (United States); Revcolevschi, A. [Laboratoire de Physico-Chimie de l'Etat Solide, Universite Paris-Sud, 91405 Orsay Cedex (France); Buttrey, D. J. [Department of Chemical Engineering, University of Delaware, Newark, Delaware 19716 (United States)




NLE Websites -- All DOE Office Websites (Extended Search)

Trinity Trinity Use Case Scenarios ( SAND 2 013---2941 P U nclassified, U nlimited R elease) Page 1 of 9 Trinity / N ERSC---8 U se C ase S cenarios April 5 , 2 013 This d ocument p rovides a dditional v iews o f a nticipated u sage s cenarios f or t wo o f the a dvanced a rchitecture f eatures o f T rinity, t he b urst b uffer a nd p ower/energy measurement a nd c ontrol. T his d ocument m ay c hange as our understanding of needs a nd t echnologies e volves. T hese scenarios are not intended to include all intended u ses o f t hese t echnologies. Format: E mbedded i n t he p rimary s cenario d escriptions a re n umbered t ags r eferring t o requirements ( listed f ollowing e ach s cenario) t hat a re i nferred b y t he s cenario. T he r eader should r ead t he s pecific r equirement, s pecified b y n umber, a t t he t ime i t i s e ncountered


OOMMF 1.2a4pre snapshots  

Science Conference Proceedings (OSTI)

... This code requires Tcl/Tk. We recommend the latest stable (ie, not alpha or beta) release of Tcl and Tk concurrent with the snapshot. ...



cv15866_JGI_PR_CR:JGI Progress Report  

NLE Websites -- All DOE Office Websites (Extended Search)

E E J G I - p o w e r i n g a s u s t a i n a b l e f u t u r e w i t h t h e s c i e n c e w e n e e d f o r b i o f u e l s , e n v i r o n m e n t a l c l e a n u p , a n d c a r b o n c a p t u r e . 2 0 0 8 P r o g r e s s R e p o r t J o i n t G e n o m e I n s t i t u t e U . S . D E P A R T M E N T O F E N E R G Y T h e c o v e r d e p i c t s v a r i o u s D O E m i s s i o n - r e l e v a n t g e n o m e s e q u e n c i n g t a r g e t s o f t h e D O E J o i n t G e n o m e I n s t i t u t e . D O E J G I M i s s i o n T h e U . S . D e p a r t m e n t o f E n e r g y J o i n t G e n o m e I n s t i - t u t e , s u p p o r t e d b y t h e D O E O f f i c e o f S c i e n c e , u n i t e s t h e e x p e r t i s e o f f i v e n a t i o n a l l a b o r a t o r i e s - L a w r e n c e B e r k e l e y , L a w r e n c e L i v e r m o r e , L o s A l a m o s , O a k R i d g e , a n d P a c i f i c N o r t h w e s t - a l o n g w i t h t h e H u d s o n A l p h a I n s t i t u t e f o r B i o t e c h n o l o g y t o a d v a n c e g e n o m i c s i n s u p p o r t o f t h e D O E m i s s i o n s r e l a t e d t o b i o e n e r g y , c a r b o n c y c l i n g , a n d b i o g e o c h e m i s t r y . J G I , l o c a t e d i n W a l n u t C r e e k , C a l i f o r n i a , p r o v i d e s i n t e g r a t e d


Microsoft Word - PR_SWG Trial Results_FINAL.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

FOR IMMEDIATE RELEASE MEDIA CONTACT FOR IMMEDIATE RELEASE MEDIA CONTACT Gary Koppenjan 805-376-6546 mediaoffice@ceres.net Ceres Yield Results: Energy Crop Benefits are Greatly Underestimated THOUSAND OAKS, Calif. - May 20, 2009 - Energy crop company Ceres, Inc. announced today that switchgrass can produce substantially more biomass than previously reported and that average yields often used by academics and policymakers to forecast bioenergy economics and environmental benefits may, in fact, be far too conservative. The company reported that yield results from its nation-wide network of field trials showed that average biomass yields among switchgrass seed varieties tested last season were as much as 50% more than the government's projected yields for 2022. Proprietary varieties sold under the



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

318 318 Title: WH Air Conditioning/Heating Repairs, 2010-2013 Description: Subcontractor shall provide all labor, materials, tools, equipment, transportation and supervision required to tear down, inspect, and perform minor repairs to the air conditioning and heating units at WH on a "will call or as needed basis" during the period from 2010 to 2013. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions).



E-Print Network (OSTI)

^eme c* *orps des fractions que A, et centr'es sur les id'eaux maximaux de A. On dit que A satisf* *ait

Darnière, Luck


engineering POstGraDuatePrOsPectus2011  

E-Print Network (OSTI)

to Glasgow and live at least 25 miles outside the city are given priority for a place in University of the University. These include a full symphonic wind band and big band, two choirs and a full-scale symphony

Mottram, Nigel


Overview of QAST 2009 , P.R. Comas1  

E-Print Network (OSTI)

,mostefa}@elda.org 4 NLE Lab. - ELiRF Research Group (UPV). Spain {prosso,dbuscaldi}@dsic.upv.es Abstract This paper Search and Retrieval; H.3.4 Systems and Software General Terms Experimentation, Performance, Measurement application of search in speech requires the transcriptions to be produced automatically, and the Automatic

Rosso, Paolo


Andrieu Bernard Pr. Epistmologie du corps et des pratiques corporelles  

E-Print Network (OSTI)

.. Modifier son corps, pourquoi ?, Paris, Ed La Martinière, 2009. 23 Pièces et main d'oeuvre, RIFD : la police

Paris-Sud XI, Université de


Phase Transformation and Magnetic Properties of Pr2Co7 ...  

Science Conference Proceedings (OSTI)

Evaluation of the Structural Strength in Railroad Car ... Synthesis and Characterization of Flame Retarding UV-Curable Boron Containing Hybrid Coatings.


Transient PrOx carbon monoxide measurement, control, and optimization  

DOE Green Energy (OSTI)

Fuel processing systems for low temperature polymer electrolyte membrane (PEM) fuel cell systems require control of the carbon monoxide concentration to less than 100 ppm to 10 ppm in the anode feed. Conventional hydrocarbon fuel processors use a water-gas shift (WGS) reactor to react CO with water to form H2 and reduce the CO concentration. The CO conversion is limited by equilibrium at the outlet temperature of the WGS reactor. The WGS outlet CO concentration can range from over 1% to 2000 ppm depending on the system and its operating parameters. At these concentrations, CO poisons low temperature PEM fuel cells and the concentrations needs to be reduced further.

Inbody, M. A. (Michael A.); Borup, R. L. (Rodney L.); Tafoya, J. (Jose I.)



21 a 26 de Maio de 2000 CURITIBA (PR) -BRASIL  

E-Print Network (OSTI)

Electricity Markets1 Shmuel S. Oren2 University of California at Berkeley USA 1 This paper benefited from's own views. 2 Department of IEOR, University of California at Berkeley, Berkeley, CA 94720 USA Oren demand on a longer time scale basis in view of the inherent fluctuation and uncertainty in demand


About PR Newswire Contact PR Newswire PR Newswire's Terms of Use Apply Careers Privacy Site Map RSS Feeds Copyright 1996-2010 PR Newswire Association LLC. All Rights Reserved.  

E-Print Network (OSTI)

in countries like the USA, China and India each year. Utilizing an exclusively licensed patent from and manufacturing technologies," adds Mr. Koszo. "Our products address increasing market demand in developed-competitive. This demand will drive the Vecor Group's growth for many years." About Vecor Group The Vecor Group develops


Table HC1-12a. Housing Unit Characteristics by West Census Region,  

U.S. Energy Information Administration (EIA) Indexed Site

2a. Housing Unit Characteristics by West Census Region, 2a. Housing Unit Characteristics by West Census Region, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total U.S. West Census Region RSE Row Factors Total Census Division Mountain Pacific 0.5 1.0 1.7 1.1 Total .............................................................. 107.0 23.3 6.7 16.6 NE Census Region and Division Northeast ..................................................... 20.3 -- -- -- NF New England ............................................. 5.4 -- -- -- NF Middle Atlantic ........................................... 14.8 -- -- -- NF Midwest ....................................................... 24.5 -- -- -- NF East North Central ..................................... 17.1 -- -- -- NF West North Central ....................................


Notes 12. (a) Annular pressure (damper) seals, and (b) Hydrostatic journal bearings  

E-Print Network (OSTI)

The mechanism of centering stiffness in seals. Force coefficients for short-length pressure seals. Design of annular seals: swirl brakes, impact on rotordynamics. Hydrostatic bearings in modern applications. The principle of hydrostatic lubrication. Effects of recess volume-fluid compressibility on force coefficients for operation at low and high frequencies. Applications of hydrostatic bearings

San Andres, Luis



diff -crN oommf-1.2a2/CHANGES oommf/CHANGES  

Science Conference Proceedings (OSTI)

... renamed the port.h header file to ocport.h. + - support for Tcl/Tk up through release 8.4.1. +. ... support for Tcl/Tk up through release 8.4.1. +. ...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


diff -crN oommf-1.2a0/CHANGES oommf/CHANGES  

Science Conference Proceedings (OSTI)

... 31,37 ****. with pre-compiled executables compatible with Tcl/Tk 8.3.x. Type. ... tclsh83 oommf.tcl pimake upgrade. tclsh83 oommf.tcl. ...


Table 8.12a Electric Noncoincident Peak Load and Capacity ...  

U.S. Energy Information Administration (EIA)

7 East Central Area Reliability Coordination Agreement (ECAR). 20 United States excluding Alaska and Hawaii. 8 ECAR, MAAC, and MAIN dissolved at the ...


CEWEP -Confederation of European Waste-to-Energy Plants Boulevard Clovis 12A  

E-Print Network (OSTI)

follow at a distance, are energy from Landfill Gas (LFG) extraction, co-incineration of SRF (Solid; BEP ­ Biomass Energy Plants; LFG ­ Landfill Gas; WtE ­ Waste-to-Energy 1 Excluding agricultural policy would be even more ambitious, replacing landfilling). Both the supply of renewable electricity


Table HC1-2a. Housing Unit Characteristics by Year of Construction,  

U.S. Energy Information Administration (EIA) Indexed Site

2a. Housing Unit Characteristics by Year of Construction, 2a. Housing Unit Characteristics by Year of Construction, Million U.S. Households, 2001 Housing Unit Characteristics RSE Column Factor: Total Year of Construction RSE Row Factors 1990 to 2001 1 1980 to 1989 1970 to 1979 1960 to 1969 1950 to 1959 1949 or Before 0.5 1.6 1.2 1.0 1.1 1.1 0.8 Total ............................................... 107.0 15.5 18.2 18.8 13.8 14.2 26.6 4.3 Census Region and Division Northeast ...................................... 20.3 1.5 2.4 2.1 2.8 3.0 8.5 8.8 New England .............................. 5.4 0.4 0.7 0.4 0.8 0.9 2.3 11.3 Middle Atlantic ............................ 14.8 1.1 1.7 1.7 2.0 2.2 6.2 11.2 Midwest ......................................... 24.5 2.8 3.7 3.6 2.9 3.5 8.1 10.2 East North Central ...................... 17.1 2.0 2.5 2.5 2.0 2.6 5.5 11.9


J12: A Modified Pidgeon Process for Energy Savings and Low ...  

Science Conference Proceedings (OSTI)

A18: Effect of Local Alendronate Delivery on In Vivo Osteogenesis From PCL ... A7: On-the-fly System Design for High Precision/Ultra Fast/Wide Area Fabrication .... C19: Dissolution Behavior of Cu Under Bump Metallization in Ball Grid Array ... High Volume and Fast Turnaround Automated Inline TEM Sample Preparation.


Microsoft Word - MillerBaldTaftPR_Lines_CX Memo.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4, 2013 4, 2013 REPLY TO ATTN OF: KEC-4 SUBJECT: Environmental Clearance Memorandum Dave Tripp Project Manager - TEP-CSB-1 Proposed Action: Bald Mountain, Miller Peak, Lines Creek, and Taft Passive Repeater Communication Upgrades Categorical Exclusion Applied (from Subpart D, 10 C.F.R. Part 1021): B1.19 Microwave, meterological amd radio towers Location: Mineral and Missoula counties, Montana; Shoshone County, Idaho Proposed by: Bonneville Power Administration (BPA) Description of the Proposed Action: BPA proposes to replace the analog communication system with a new digital communication system at four existing communication sites in Montana and Idaho to enable the connection of the digital circuits and ensure communication reliability. All of the sites are located on land managed by


Please continue to the next page... ENGINEERING & SCIENCE s pr i ng 200922  

E-Print Network (OSTI)

a fiber-optic cable into the esophagus to deliver the photons. When exposed to the light, the dye produces. Right: The four LEDs at the base of the new probe shine in infrared light. A camera connected is the science and technology of using light in biology, or as he puts it, "We use optics in clever ways to solve

Yang, Changhuei


Submitted to the Annals of Applied Probability arXiv: math.PR/0803.3042  

E-Print Network (OSTI)

, Structure and stability of certain chemical networks and applications to the kinetic proofreading of t on the network of a stochastically modeled chemical system with quite general kinetics, then there exists to systems with more general kinetics. 2. Chemical reaction networks. Consider a system with m chemical

Craciun, Gheorghe


Wildlife Research Pi^lems Pr^f^ms Pro^,|s w  

E-Print Network (OSTI)

;FOREWORD There are twice as many people in the United States now as there were 50 years ago. The gross- ing the year, 4.2 percent less than during the pre- vious year. The decreases are attributed to severe during the 4-year period, increasing the first 2 years, but declining 63 percent below the peak


Climatological Validation of TRMM TMI and PR Monthly Rain Products over Oklahoma  

Science Conference Proceedings (OSTI)

This paper reports the results from a regional validation study of monthly precipitation products generated from sensor measurements aboard the Tropical Rainfall Measuring Mission (TRMM) satellite. The study analyzed 4 yr of precipitation ...

Brad L. Fisher



Dynamic (G2) Model Design Document, 24590-WTP-MDD-PR-01-002, Rev. 12  

SciTech Connect

The Hanford Tank Waste Treatment and Immobilization Plant (WTP) Statement of Work (Department of Energy Contract DE-AC27-01RV14136, Section C) requires the contractor to develop and use process models for flowsheet analyses and pre-operational planning assessments. The Dynamic (G2) Flowsheet is a discrete-time process model that enables the project to evaluate impacts to throughput from eventdriven activities such as pumping, sampling, storage, recycle, separation, and chemical reactions. The model is developed by the Process Engineering (PE) department, and is based on the Flowsheet Bases, Assumptions, and Requirements Document (24590-WTP-RPT-PT-02-005), commonly called the BARD. The terminologies of Dynamic (G2) Flowsheet and Dynamic (G2) Model are interchangeable in this document. The foundation of this model is a dynamic material balance governed by prescribed initial conditions, boundary conditions, and operating logic. The dynamic material balance is achieved by tracking the storage and material flows within the plant as time increments. The initial conditions include a feed vector that represents the waste compositions and delivery sequence of the Tank Farm batches, and volumes and concentrations of solutions in process equipment before startup. The boundary conditions are the physical limits of the flowsheet design, such as piping, volumes, flowrates, operation efficiencies, and physical and chemical environments that impact separations, phase equilibriums, and reaction extents. The operating logic represents the rules and strategies of running the plant.

Deng, Yueying; Kruger, Albert A.



Study on the Interaction Coefficients in PR Equation with VdW ...  

Science Conference Proceedings (OSTI)

... The values of ki for HFCs and HCs, including Propane, Isobutane, n-butane, HFC32, HFC125, HFC134a, HFC143a, HFC152a and HFC227ea ...



41S PR I NG 2012 ENGINEERING & SCIENCE Nicholas W. Tschoegl, professor of  

E-Print Network (OSTI)

Kemakh Tiras Flour Kemakh Flour (whole wheat Kemakh Maleh Flour (self rising) Kemakh Tofe'akh Sugar Sukar Vanilla extract Tamseet vanil Yeast Chmarim Bread Lekhem Bread (whole wheat) Lekhem Maleh Cake Uga Cookies


Pr opagation of mist dislocations from AlN/Si int erface int ...  

needs to be gro wn using foreign substrat es such as Al 2 O 3 or SiC. Ther efore, differe nt appr oaches need to be applied, such as lat eral


100- The Effect of Mn and Pr Co-Doping on Electrical Properties of ...  

Science Conference Proceedings (OSTI)

144- The Role of Mn Content on Microstructure and Phases of High Alloyed White Cast Irons 145- The Synergy of XRD and XRF in a Shale and Slate Analysis.


Chemical Expansion and Frozen-In Oxygen Vacancies in Pr-Doped Ceria  

E-Print Network (OSTI)

Doped CeO2 is a promising candidate for solid oxide fuel cell electrolyte and electrode applications because of its high ionic conductivity and reduction/oxidation behavior at intermediate temperatures. Its electronic and ...

Kuru, Yener



Structural and Magnetic Properties of Nanocrystalline Pr2Co7Cx ...  

Science Conference Proceedings (OSTI)

Synthesis of Monolithic Iron Incorporated Silica Aerogels by Ambient Pressure Drying Synthesis of Ultrahigh-density Sub 10 nm Co Nanowires Arrays by the...


s pr i ng 2010 ENGINEERING & SCIENCE 41 Consider the following closed  

E-Print Network (OSTI)

-y richting ongeveer 1 ?/s. EERSTE METINGEN Als eerste modelsysteem hebben wij Fisher-Tropsch synthese op Co als industriële Fischer-Tropsch katalysator, met STM gasgeïnduceerde verruwing is waargenomen [1], en


Mechanical, Electrical, and Optical Properties of (Pr,Ce)O[subscript 2] Solid Solutions: Kinetic Studies  

E-Print Network (OSTI)

Praseodymium doped cerium oxide (PCO) shows mixed ionic and electronic conducting (MIEC) characteristics at relatively high pO2 (e.g. air) and enhanced oxygen storage capacity (OSC), of interest for solid oxide fuel cell ...

Chen, Di


A :netao '?X,S vrtttcn (XX-x-162) to ;,r+ allison dascrllltnPr...  

Office of Legacy Management (LM)

XeJuction an& nurification methods for the metal should be sou&t ano the 12 usefulnas? oiL:stillation should be Determined. Sneddiw' s work on' 9e reduct.Zoa and- : castin? 2nd...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


PR-A (Progesterone Receptor A) Transgenic Mice Allow Study of ...  

Research Tools; Developing World; Energy. Energy Efficiency; ... Study of the endocrine basis of breast cancer and cancer of the female reproductive ...



E-Print Network (OSTI)

as a homogeneous medium which is occupied by a liquid and a solid phase, say water and ice, that initially occupy is growing, š points into the solid phase, and Ÿ is positive for a water ball surrounded by ice, and negative. Introduction The classical Stefan problem is a model for phase transitions in solid­liquid sys­ tems

Simonett, Gieri



NLE Websites -- All DOE Office Websites (Extended Search)

Continental Shelf, Mr. Bush again asked Congress to allow the development of oil from oil shale on federal lands, and for the authorities to expedite the necessary upgrades and...


Antiferromagnetism in Pr3In: Singlet/triplet physics with frustration  

E-Print Network (OSTI)

82. Work performed at the HFIR Center for Neutron ScatteringHigh Flux Isotope Reactor (HFIR) at the Oak Ridge National



Relationship Between Heat Flows and Geological Structures in the Sichuan Basin, P.R. China  

DOE Green Energy (OSTI)

Based on an extensive data collection and analysis, this research has provided reliable representations of the features of the geothermal fields, their heat flow, and relationships with geological structures in the Sichuan Basin. The isotherms below a depth of 1,000 m show high values in the Central Uplift and the Southwest Uplift, and low values in the Northwest and Southeast Depressions. These features probably indicate undulation of crystalline basement and structural depression. At depths greater than 3,000 m, the isotherms tend to become simpler and regionalized. The mean heat flow in the basin is 69.1 mW/m{sup 2}. In the Central Uplift, the Northwest Depression and the East of the basin, heat-flow values range from 58.6 to 71.2 mW/m{sup 2}, with a mean value of 66.1 mWE/m{sup 2}. In the south and southwest, it varies from 76.6 to 100.5 mW/m{sup 2}, with a mean value of 86.2 mW/m{sup 2}. High heat-flow values occur within the uplift of the crystalline basement in the southwest Sichuan, and the heat flow decreases from the south, through the central area, to the northwest.

Zeng, Y.; Yu, H.; Wang, X.



Preliminary Gas and Isotope Geochemistry in the Rehai Geothermal Field, P.R. China  

DOE Green Energy (OSTI)

Based on gas and sulphur isotopic composition, two types of steam in Rehai geothermal field are identified. One is with higher CO{sub 2} and H{sub 2}S concentration, the {delta}{sup 34}S of H{sub 2}S is in the range 2.49{per_thousand} to -1.04{per_thousand} (vs CDT), from which the H{sub 2}S-temperature is over than 250 C. The other is with lower CO{sub 2} and H{sub 2}S concentration, the {delta}{sup 34}S of H{sub 2}S is in the range -4.0{per_thousand} to -8.36{per_thousand}, from which the H{sub 2}S- and H{sub 2}-temperatures are 180 C-210 C, in good agreement with quartz temperature. The thermal water in the Rehai field is of local meteoric origin. Maximum {delta}{sup 18}O-value shift is less than 2.0{per_thousand} (vs SMOW). Mixing is widespread and could be identified on isotope and solute chemistry.

P., Zhao; Z., Liao



25S PR I NG 2012 ENGINEERING & SCIENCE As scientists extend the limits of  

E-Print Network (OSTI)

of the day when she'll be able to type into a computer, "I need something lightweight like an aerogel--how to build bulk materials with those same properties. The tool of choice for measuring mechanical properties


Pr?ediction de synt?enies dans le g?enome ancestral des ... - CECM  

E-Print Network (OSTI)

de poissons (en haut et en bas), alors que la paralogie entre les deux segments de poissons n'est pas d?tectable. (peu de g`enes sont conserv?s en deux...


Rain Retrieval from TMI Brightness Temperature Measurements Using a TRMM PRBased Database  

Science Conference Proceedings (OSTI)

This study focuses on improving the retrieval of rain from measured microwave brightness temperatures and the capability of the retrieved field to represent the mesoscale structure of a small intense hurricane. For this study, a database is ...

Nicolas Viltard; Corinne Burlaud; Christian D. Kummerow



Magnetism and superconductivi[t]y in Pr-based filled skutterudite arsenides  

E-Print Network (OSTI)

5.4.2 Electrical Resistivity . . . . . . . . . . . . . . .3.2 Electrical Resistivity . . . . . . . . . . . . . .3.2.3 CEF E?ects on Electrical Resistivity . . 3.3

Sayles, Todd Allen



Genome Data from DOOR: a Database for prOkaryotic OpeRons  

DOE Data Explorer (OSTI)

DOOR provides an Organism View for browsing, a gene search tool, an operon search tool, and the operon prediction interface.[Text taken and edited from http://csbl1.bmb.uga.edu/OperonDB/tutorial.php


Session T3H San Juan, PR July 23 28, 2006  

E-Print Network (OSTI)

, microhydro generators, cogeneration systems, etc.), a number of direct PV power injection systems, consumer

Simões, Marcelo Godoy



U.S. Energy Information Administration (EIA) Indexed Site

2a. Usage Indicators by West Census Region, 2a. Usage Indicators by West Census Region, Million U.S. Households, 2001 ____________________________________________________________________________________________ | | | | | West Census Region | | |___________________________________| | | | | | | | Census Division | | | |_______________________|


Data:12a700f2-b169-42ae-bcdf-25646587ea4b | Open Energy Information  

Open Energy Info (EERE)

-b169-42ae-bcdf-25646587ea4b -b169-42ae-bcdf-25646587ea4b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Loup River Public Power Dist Effective date: 2013/01/15 End date if known: Rate name: District Owned Lighting EMH 11000 Sector: Commercial Description: Source or reference: http://www.loup.com/customersvc/rates.asp Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>


Data:12a45141-7972-4ec8-a2dc-37fedc8133d3 | Open Energy Information  

Open Energy Info (EERE)

5141-7972-4ec8-a2dc-37fedc8133d3 5141-7972-4ec8-a2dc-37fedc8133d3 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Ameren Illinois Company Effective date: 2010/11/19 End date if known: Rate name: DS-2 Zone 2 - Small General Delivery Service 600V to 15kV Sector: Commercial Description: AVAILABILITY Service under this Rate is available for any eligible Non-Residential Customer within the territory served by Company that meets the following criteria: Customers served under this Rate shall have a maximum monthly Demand of less than 150 kilowatts (kW) as qualified in the Delivery Service Rate Reassignment section. A Customer without a demand meter installed, but with an average usage of less than 1,200 kWh per day during each monthly billing period will be normally assumed to have a maximum monthly Demand of less than 150 kW. Where Customer's average daily usage is 1,200 kWh per day or more in any monthly billing period, Company may install a demand meter at Company's expense to determine if Customer remains eligible for service under this Rate.


Generalized redundancies for time series analysis Dean Prichard 1;2a and James Theiler 2;3  

E-Print Network (OSTI)

, Nonproliferation and International Security Division, Los Alamos National Laboratory, Los Alamos, NM 87545 3 Santa

Theiler, James


diff -crN oommf12a3/app/mmdisp/scripts/avf2ovf.tcl oommf ...  

Science Conference Proceedings (OSTI)

... REAL8m>(step_count); Happ.push_back(((1-t)*h0) + (t*h1)); } + if(step_count> 0) Happ.push_back(h1); + } + vector::iterator it = Happ ...



Parametrization of a reactive force field for aluminum hydride J. G. O. Ojwang,1,2,a  

E-Print Network (OSTI)

the total energy of atomic hydro- gen instead of that of molecular hydrogen. Therefore, in Table VIII we of hydro- gen desorption in the two instances are similar. In Fig. 5 ii there is a slight rise in energy is the development of solid-state hydrogen storage media for vehicles. The United States' Department of Energy Do

Goddard III, William A.


07/06/2006 12:16 PMhttp://fti.neep.wisc.edu/MISC/EWFullPR07.htm Page 1 of 6http://fti.neep.wisc.edu/MISC/EWFullPR07.htm  

E-Print Network (OSTI)

&D and Integration Facility h ardware integration, mock-ups & in stallation Shielding/Remote Handling Integration. · Running fibers hot only affects the long-term absorption. · Great disparity in radiation effects in an -diagnostic Plasma 90° 60° 45° 20° Vacuum Vessel Test Cell Floor Quartz coherent fiber optic bundles Radiation


Estimation of Latent Heating of Rainfall during the Onset of the Indian Monsoon Using TRMM PR and Radiosonde Data  

Science Conference Proceedings (OSTI)

The objective of this study is to estimate the vertical structure of the latent heating of precipitation in the vicinity of the Himalayas. Based on a cloud physics parameterization and the thermodynamic equilibrium equation, a simple algorithm is ...

Ramata Magagi; Ana P. Barros


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

We analyse an effect of electron Fermi motion at atomic shells on the accuracy of electron beam polarization measurements with a Mller polarimeter operating in a doublearm mode. It is demonstrated that the effect can result in either increase or decrease of the measured polarization depending on the detector positions. The effect is simulated for the Mller polarimeter to be installed at CEBAF Hall A. To be submitted to Nuclear Instruments and Methods

Andrei Afanasev; Alexander Glamazdin




NLE Websites -- All DOE Office Websites (Extended Search)

by the team of technical and management approach? Answer: The Source Evaluation Board will conduct an oral presentation session with the offeror's Key Personnel who shall...


Site disorder and spin-glass ordering in PrAu2Si2 D. H. Ryana  

E-Print Network (OSTI)

, Canada I. P. Swainson Neutron Program for Materials Science, Chalk River Laboratories, Chalk River to this argument. It is clear that the body centered tetragonal ThCr2Si2-type I4/mmm crystal structure supports AF

Ryan, Dominic


Spectral Retrieval of Latent Heating Profiles from TRMM PR Data. Part I: Development of a Model-Based Algorithm  

Science Conference Proceedings (OSTI)

An algorithm, the spectral latent heating (SLH) algorithm, has been developed to estimate latent heating profiles for the Tropical Rainfall Measuring Mission precipitation radar with a cloud-resolving model (CRM). Heating-profile lookup tables ...

Shoichi Shige; Yukari N. Takayabu; Wei-Kuo Tao; Daniel E. Johnson



Latent Heating and Cooling Rates in Developing and Nondeveloping Tropical Disturbances during TCS-08: TRMM PR versus ELDORA Retrievals  

Science Conference Proceedings (OSTI)

Unique sets of Electra Doppler Radar (ELDORA) observations in both developing and nondeveloping tropical disturbances in the western North Pacific are used to retrieve latent heating and cooling rates. During the reintensification of Sinlaku, ...

Myung-Sook Park; Russell L. Elsberry



Hole-burning techniques for isolation and study of individual hyperfine transitions in inhomogeneously broadened solids demonstrated in Pr3+  

E-Print Network (OSTI)

Hole-burning techniques for isolation and study of individual hyperfine transitions been limited. However, here we present spectroscopic techniques, based on spectral hole burning of hole-burning pulses is used to isolate selected transitions between hyperfine levels, which makes

Suter, Dieter


DOE_EE0003592_HEL-SR-PR-0027 Rev 1 20130227 Final Report_Public Release  

SciTech Connect

To develop a high temperature Thermal Storage System (TES) based on graphite and able to provide both economical and technical advantages with respect to existing solutions contributing to increase the share of Concentrated Solar Plants (CSP).

Eduardo Villarroel, Carlos Fernandez-Pello, Jeff Lenartz, Karen Parysek



EM for mixtures STA705 Spring 2006  

E-Print Network (OSTI)

, ) = Pr(cij = 1, yi, ) Pr(yi, ) = Pr(cij = 1, yi, ) k m=1 Pr(cim = 1, yi, ) = Pr(yi|cij = 1, )Pr(cij = 1|) k m=1 Pr(yi|cim = 1, )Pr(cim = 1|) = pjN(µj, 2 j )(yi) k m=1 pmN(µm, 2 m)(yi) For the maximization

Viele, Kert


2013 Science Bowl | Princeton Plasma Physics Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

Bowl View larger image 13 PR 0222 189 View larger image 13 PR 0222 194 View larger image 13 PR 0222 189 View larger image 13 PR 0222 195 View larger image 13 PR 0222 200 View...


Gestion des auto-occultations pour l'augmentation d'une surface deformable V. Gay-Bellile1,2  

E-Print Network (OSTI)

Gestion des auto-occultations pour l'augmentation d'une surface d´eformable V. Gay-Bellile1,2 A peu. La surface est habituellement suppos´ee ne pas s'auto-occulter. En effet, l'estimation d'une fonction de d´eformation en pr´esence d'auto-occultations s'av`ere complexe. Cette article propose un

Bartoli, Adrien


Data:175de12a-c7bb-4312-8cd7-5013d702e8e6 | Open Energy Information  

Open Energy Info (EERE)

2a-c7bb-4312-8cd7-5013d702e8e6 2a-c7bb-4312-8cd7-5013d702e8e6 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Shelby, Ohio (Utility Company) Effective date: End date if known: Rate name: Schedule B- Three Phase Sector: Description: Delivery Voltages: $0.15/kVA Source or reference: http://www.amlegal.com/nxt/gateway.dll/Ohio/shelby_oh/parttenstreetsutilitiesandpublicservices/titlefour-utilities/chapter1050electricity?f=templates$fn=default.htm$3.0$vid=amlegal:shelby_oh$anc=JD_1050.02 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh)


Data:12a99515-0eda-4991-8ebe-b838e14266e0 | Open Energy Information  

Open Energy Info (EERE)

15-0eda-4991-8ebe-b838e14266e0 15-0eda-4991-8ebe-b838e14266e0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Columbus Southern Power Co Effective date: 2012/03/09 End date if known: Rate name: Residential Storage Water Heating Energy Charge Sector: Residential Description: Storage Water Heating Provision: Availability of this provision is limited to those customers served under this provision as of December 31,2000.If the customer installs a Company approved storage water heating system which consumes electrical energy only during off-peak hours as specified by the Company and stores hot water for use during on-peak hours, the following shall apply: (a) For minimum capacity of 80 gallons, the last 300 KWH of use in any month shall be billed at the storage water heating energy charge. (Schedule Code 016)


Data:D12a4ee9-489c-4929-96b2-6324a0b8e925 | Open Energy Information  

Open Energy Info (EERE)

ee9-489c-4929-96b2-6324a0b8e925 ee9-489c-4929-96b2-6324a0b8e925 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Raton Public Service Company Effective date: End date if known: Rate name: Security Lights 3- Prompt Payment Discount Sector: Lighting Description: Security lights are available to all (except as noted) residential, commercial and industrial customers served by the Raton Public Service Company for outside lighting purposes at the voltage and phase of the company's distribution system. RPS owns fixture and pole, power is furnished by customer. RPS furnishes parts & service.


Data:65a49a12-a982-4cf5-8447-6f7ea00191e7 | Open Energy Information  

Open Energy Info (EERE)

a982-4cf5-8447-6f7ea00191e7 a982-4cf5-8447-6f7ea00191e7 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Anoka, Minnesota (Utility Company) Effective date: 2012/04/01 End date if known: Rate name: Parallel Generation Rate Time of Day Purchase Rate Industrial Sector: Industrial Description: Less than 40KW Source or reference: Rate Binder Kelly 3 ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category:


Data:6e12a440-93b5-4896-a479-0a2a32a05d2a | Open Energy Information  

Open Energy Info (EERE)

2a440-93b5-4896-a479-0a2a32a05d2a 2a440-93b5-4896-a479-0a2a32a05d2a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Intermountain Rural Elec Assn Effective date: End date if known: 2013/02/01 Rate name: Residential Time of Use (A-TOU) Sector: Residential Description: Residential Time of Use rate. Assumes all adjustments are included. Source or reference: Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous


Data:12a72f65-3385-4f7c-ab20-1355dd6f6a6b | Open Energy Information  

Open Energy Info (EERE)

-3385-4f7c-ab20-1355dd6f6a6b -3385-4f7c-ab20-1355dd6f6a6b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tri-County Elec Member Corp Effective date: 2008/10/01 End date if known: Rate name: Outdoor Lighting HPS Underground Flood 400 W Sector: Lighting Description: Assuming Existing Pole Source or reference: http://www.tri-countyemc.com/skins/userfiles/file/Outdoor_lighting_1_2_3.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service


Data:0b12a8f0-ce39-41bc-b6cf-16606647c57c | Open Energy Information  

Open Energy Info (EERE)

a8f0-ce39-41bc-b6cf-16606647c57c a8f0-ce39-41bc-b6cf-16606647c57c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Cuba City, Wisconsin (Utility Company) Effective date: 2009/10/14 End date if known: Rate name: Gs-1 General Service Three Phase Sector: Commercial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0765 per kilowatt-hour.


Data:F4d71c12-a075-4e42-ab03-ab9047022664 | Open Energy Information  

Open Energy Info (EERE)

a075-4e42-ab03-ab9047022664 a075-4e42-ab03-ab9047022664 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Borough of Kutztown, Pennsylvania (Utility Company) Effective date: End date if known: Rate name: INSTITIONAL SERVICE RATE120000 Sector: Commercial Description: Source or reference: http://www.kutztownboro.org/kutztown/uploads/ElectricRatesJanuary2012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:


Data:B12a96b8-e5dc-4002-a47e-f82fe67c5828 | Open Energy Information  

Open Energy Info (EERE)

b8-e5dc-4002-a47e-f82fe67c5828 b8-e5dc-4002-a47e-f82fe67c5828 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Mille Lacs Energy Cooperative Effective date: End date if known: Rate name: General Service Sector: Residential Description: Availability Available for all non-commercial service Source or reference: Rate Binder A Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>


Data:424a30a1-d12a-4cb7-b0f4-9285e6014872 | Open Energy Information  

Open Energy Info (EERE)

2a-4cb7-b0f4-9285e6014872 2a-4cb7-b0f4-9285e6014872 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Kit Carson Electric Coop, Inc Effective date: 2011/09/22 End date if known: Rate name: Market Based Rate Schedule Sector: Industrial Description: Available to all consumers within the Utility's service area who have entered into a contract, with a term of at least one year, for demand of 1,000 kW or more. Service shall be supplied through a point of delivery and measured through primary metering. Source or reference: www.kitcarson.com Source Parent: Comments Applicability Demand (kW)

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:12a1bed7-432b-4810-83de-351ba5b1d371 | Open Energy Information  

Open Energy Info (EERE)

-432b-4810-83de-351ba5b1d371 -432b-4810-83de-351ba5b1d371 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Tipton Municipal Electric Util Effective date: 2004/08/13 End date if known: Rate name: Rate E- Outdoor Lighting Service: 400 Watt Metal Halide Sector: Lighting Description: Add $1.15 per month, if pole installation is required. Source or reference: Rates Binder 1, Illinois State University Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service


Data:466ba082-9e49-4eac-a12a-24da3651e616 | Open Energy Information  

Open Energy Info (EERE)

WIND MACHINE SERVICE RATE SCHEDULE E-40 Sector: Commercial Description: AVAILABILITY This rate schedule is available in all territory served by the Company at all...


ZPR-3 Assembly 12 : A cylindrical assembly of highly enriched uranium, depleted uranium and graphite with an average {sup 235}U enrichment of 21 atom %.  

Science Conference Proceedings (OSTI)

Over a period of 30 years, more than a hundred Zero Power Reactor (ZPR) critical assemblies were constructed at Argonne National Laboratory. The ZPR facilities, ZPR-3, ZPR-6, ZPR-9 and ZPPR, were all fast critical assembly facilities. The ZPR critical assemblies were constructed to support fast reactor development, but data from some of these assemblies are also well suited for nuclear data validation and to form the basis for criticality safety benchmarks. A number of the Argonne ZPR/ZPPR critical assemblies have been evaluated as ICSBEP and IRPhEP benchmarks. Of the three classes of ZPR assemblies, engineering mockups, engineering benchmarks and physics benchmarks, the last group tends to be most useful for criticality safety. Because physics benchmarks were designed to test fast reactor physics data and methods, they were as simple as possible in geometry and composition. The principal fissile species was {sup 235}U or {sup 239}Pu. Fuel enrichments ranged from 9% to 95%. Often there were only one or two main core diluent materials, such as aluminum, graphite, iron, sodium or stainless steel. The cores were reflected (and insulated from room return effects) by one or two layers of materials such as depleted uranium, lead or stainless steel. Despite their more complex nature, a small number of assemblies from the other two classes would make useful criticality safety benchmarks because they have features related to criticality safety issues, such as reflection by soil-like material. ZPR-3 Assembly 12 (ZPR-3/12) was designed as a fast reactor physics benchmark experiment with an average core {sup 235}U enrichment of approximately 21 at.%. Approximately 68.9% of the total fissions in this assembly occur above 100 keV, approximately 31.1% occur below 100 keV, and essentially none below 0.625 eV - thus the classification as a 'fast' assembly. This assembly is Fast Reactor Benchmark No. 9 in the Cross Section Evaluation Working Group (CSEWG) Benchmark Specifications and has historically been used as a data validation benchmark assembly. Loading of ZPR-3 Assembly 12 began in late Jan. 1958, and the Assembly 12 program ended in Feb. 1958. The core consisted of highly enriched uranium (HEU) plates, depleted uranium plates and graphite plates loaded into stainless steel drawers which were inserted into the central square stainless steel tubes of a 31 x 31 matrix on a split table machine. The core unit cell consisted of two columns of 0.125 in.-wide (3.175 mm) HEU plates, seven columns of 0.125 in.-wide depleted uranium plates and seven columns of 0.125 in.-wide graphite plates. The length of each column was 9 in. (228.6 mm) in each half of the core. The graphite plates were included to produce a softer neutron spectrum that would be more characteristic of a large power reactor. The axial blanket consisted of 12 in. (304.8 mm) of depleted uranium behind the core. The thickness of the radial blanket was approximately 12 in. and the length of the radial blanket in each half of the matrix was 21 in. (533.4 mm). The assembly geometry approximated a right circular cylinder as closely as the square matrix tubes allowed. According to the logbook and loading records for ZPR-3/12, the reference critical configuration was loading 10 which was critical on Feb. 5, 1958. The subsequent loadings were very similar but less clean for criticality because there were modifications made to accommodate reactor physics measurements other than criticality. Accordingly, ZPR-3/12 loading 10 was selected as the only configuration for this benchmark. As documented below, it was determined to be acceptable as a criticality safety benchmark experiment. An accurate transformation to a simplified model is needed to make any ZPR assembly a practical criticality-safety benchmark. There is simply too much geometric detail in an exact (as-built) model of a ZPR assembly, even a clean core such as ZPR-3/12 loading 10. The transformation must reduce the detail to a practical level without masking any of the important features of the critical experiment. And it must d

Lell, R. M.; McKnight, R. D.; Perel, R. L.; Wagschal, J. J.; Nuclear Engineering Division; Racah Inst. of Physics



Pages that link to "Data:De12a8fe-13b5-4491-9139-ea729b96ec3d...  

Open Energy Info (EERE)

91-9139-ea729b96ec3d: View (previous 50 | next 50) (20 | 50 | 100 | 250 | 500) City of Seattle, Washington (Utility Company) ( links) View (previous 50 | next 50) (20 | 50 |...


Data:72b22d28-179d-417f-83f5-80f86e12a95a | Open Energy Information  

Open Energy Info (EERE)

Sector: Lighting Description: Applicable for dusk to dawn lighting service by means of ballast operated lamp fixtures on a suitable wood pole. The service includes all electrical...


European Union Wind Energy Forecasting Model Development and Testing: U.S. Department of Energy -- EPRI Wind Turbine Verification Pr ogram  

Science Conference Proceedings (OSTI)

Wind forecasting can increase the strategic and market values of wind power from large wind facilities. This report summarizes the results of the European Union (EU) wind energy forecasting project and performance testing of the EU wind forecasting model. The testing compared forecast and observed wind speed and generation data from U.S. wind facilities.




E-Print Network (OSTI)

Report: Methane emissions assessment in South African coal mines and their potential utilizations MPANA(Hon)(Elect) MIng(Elect) DIng (RAU) FSAAE Doctor of Philosophy AFENI, Busuyi Thomas School of Mining Engineering measurement in a surface mine environment. The impact of taking measurement through a glass medium BUGARIN

Wagner, Stephan


Video Camera Use at Nuclear Power Plants: Tools for Increasing Productivity and Reducing Radiation Exposure: Tools for Increasing Pr oductivity and Reducing Radiation Exposure  

Science Conference Proceedings (OSTI)

Nuclear power plants have increased the use of industrial video cameras as support tools for a variety of plant operations and outage tasks. This survey on utility use of video cameras, the equipment being used, and the benefits derived found that the video camera is an important tool for reducing radiation exposure and improving productivity through more efficient use of personnel.



Assessing Satellite-Based Rainfall Estimates in Semiarid Watersheds Using the USDA-ARS Walnut Gulch Gauge Network and TRMM PR  

Science Conference Proceedings (OSTI)

The rain gauge network associated with the Walnut Gulch Experimental Watershed (WGEW) in southeastern Arizona provides a unique opportunity for direct comparisons of in situ measurements and satellite-based instantaneous rain rate estimates like ...

Eyal Amitai; Carl L. Unkrich; David C. Goodrich; Emad Habib; Bryson Thill



Purex Plant comparison with 40 CFR 61, subpart H, and other referenced guidelines for the Product Removal (PR) (296-A-1) stack  

SciTech Connect

Dose calculations for atmospheric radionuclide releases from the Hanford Site for calendar year (CY) 1992 were performed by Pacific Northwest Laboratory (PNL) using the approved US Environmental Protection Agency (EPA) CAP-88 computer model. Emissions from discharge points in the Hanford Site 100, 200, 300, 400, and 600 areas were calculated based on results of analyses of continuous and periodic sampling conducted at the discharge points. These calculated emissions were provided for inclusion in the CAP-88 model by area and by individual facility for those facilities having the potential to contribute more than 10 percent of the Hanford Site total or to result in an impact of greater than 0.1 mrem per year to the maximally exposed individual (MEI). Also included in the assessment of offsite dose modeling are the measured radioactive emissions from all Hanford Site stacks that have routine monitoring performed. Record sampling systems have been installed on all stacks and vents that use exhaust fans to discharge air that potentially may carry airborne radioactivity. Estimation of activity from ingrowth of long-lived radioactive progeny is not included in the CAP-88 model; therefore, the Hanford Site GENII code (Napier et al. 1988) was used to supplement the CAP-88 dose calculations. When the dose to the MEI located in the Ringold area was calculated, the effective dose equivalent (EDE) from combined Hanford Site radioactive airborne emissions was shown to be 3.7E-03 mrem. This value was reported in the annual air emission report prepared for the Hanford Site (RL 1993).

Lohrasbi, J.



3,2-HOPO Complexes of Near-Infra-Red (NIR) Emitting Lanthanides: Sensitization of Ho(III) and Pr(III) in Aqueous Solution  

E-Print Network (OSTI)

Published in Angew. Chemie. Intl. Ed. 2008, publishedD 2d = Published in Angew. Chemie. Intl. Ed. 2008, publishedwas Published in Angew. Chemie. Intl. Ed. 2008, published

Moore, Evan G.



Higher Education Industry--General Staff--Award 2010 The above award was first made on 19 December 2008 [PR985117  

E-Print Network (OSTI)

Electrical Certificate III in Electrotechnology Electrician RC 15 years + employed as apprentice H, W 4P D of Commerce 76.65 20 in English (any) and in MATH METH (either) H 5F 10P V Electrical and Electronic Engineering Bachelor of Engineering (Electrical and Electronic Engineering) 76.00 20 in English (any

Cox, Grant


Transient electronic structure of the photoinduced phase of Pr0.7Ca0.3MnO3 probed with soft x-ray pulses  

E-Print Network (OSTI)

22607, Germany Advanced Photon Source, Argonne NationalLaboratory, Argonne, Illinois, 60439 USA 5 Correlatedthe Advanced Photon Source at Argonne Na- tional Laboratory.

Rini, M.



Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) Heavy Bosons Other Than  

E-Print Network (OSTI)

://pdg.lbl.gov) Heavy Bosons Other Than Higgs Bosons, Searches for We list here various limits on charged and neutral heavy vector bosons (other than W 's and Z's), heavy scalar bosons (other than Higgs bosons), vector Searches" reviews. CONTENTS:CONTENTS:CONTENTS:CONTENTS: Mass Limits for W (Heavy Charged Vector Boson


Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) Heavy Charged Lepton Searches  

E-Print Network (OSTI)

://pdg.lbl.gov) Heavy Charged Lepton Searches Charged Heavy Lepton MASS LIMITSCharged Heavy Lepton MASS LIMITSCharged Heavy Lepton MASS LIMITSCharged Heavy Lepton MASS LIMITS Sequential Charged Heavy Lepton (L±) MASS LIMITSSequential Charged Heavy Lepton (L±) MASS LIMITSSequential Charged Heavy Lepton (L±) MASS LIMITSSequential


Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) (URL: http://pdg.lbl.gov) Heavy Neutral Leptons, Searches for  

E-Print Network (OSTI)

://pdg.lbl.gov) Heavy Neutral Leptons, Searches for (A) Heavy Neutral Leptons(A) Heavy Neutral Leptons(A) Heavy Neutral Leptons(A) Heavy Neutral Leptons Stable Neutral Heavy Lepton MASS LIMITSStable Neutral Heavy Lepton MASS LIMITSStable Neutral Heavy Lepton MASS LIMITSStable Neutral Heavy Lepton MASS LIMITS Note that LEP results


Evaluation of ultrasonic inspection techniques for the root region of girth welds. Report for project A.G.A. PR-220-9123  

SciTech Connect

A system for mechanized ultrasonic inspection of girth welds during pipeline construction, the RTD Rotoscan, has already been available for almost twenty years. In fact, its development started back in the seventies, after initial trials going as far back as the fifties. First commercial use started in the beginning of the eighties. Today, RTD Rotoscans are being used all over the world whereby, for a number of pipeline projects, it replaces radiography as a sole girth weld inspection technique. It has been known for many years, that the main difficulty in mechanized ultrasonic inspection of pipeline girth welds is in a reliable inspection of the root region. The objectives of this program were to: evaluate the merits of several mechanized ultrasonic insection techniquese; evaluate systems already suitable to fulfill the objective; establish possibilities and restrictions and to provide guidelines for their selection both technically and economically; and to indicate further development work for promising methods or systems which can be made suitable for field applications.

Ent, J. van der; Dijkstra, F.H. [Roentgen Technische Dienst bv (Netherlands)



Regulation of motility, the cell cycle, and magnetosome formation in Magnetospirillum magneticum AMB-1  

E-Print Network (OSTI)

r epair enzyme hypot het ical pr ot ein Nif Q pr ot ein f erhypot het ical pr ot ein Nif X pr ot ein nit r ogenasexU-like pr ot ein put at ive nif Z pr ot ein hypot het ical

Greene, Shannon Elizabeth



Nuclear Structure and Nuclear Reactions | Argonne Leadership...  

NLE Websites -- All DOE Office Websites (Extended Search)

the ab initio no-core full configuration approach," Phys. Rev. C 86, 034325 (2012) Nuclear Structure and Nuclear Reactions PI Name: James Vary PI Email: jvary@iastate.edu...


Chemical Rearrangement under Hydrothermal Conditions: Formation of Polymeric Chains (CuX)2(dpiz) and (CuX)3(dpiz) (X ) Cl, Br; dpiz ) Dipyrido[1,2-a:2,3-d]imidazole) and Crystal Structures of  

E-Print Network (OSTI)

due to their excellent redox catalytic abilities.10 In this Communication, we report the synthesisL acid digestion bombs at 170 °C afforded orange crystals of 1 [(CuCl)2(C10H7N3)] (I) and 1 [(CuBr)3(C crystallographically independent copper sites in this common motif. Cu(1), the Cu atom in the tetrahedral site

Li, Jing

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Data:E6782d3f-9dca-4fb8-88c1-2a34a6a548d8 | Open Energy Information  

Open Energy Info (EERE)

in the fall of 2008. Source or reference: UtilityRateAPCo-WPCo-July-2008-Tariff-Book.pdf Assume net metering (buy sell): Flat rate buy (kWh): Flat rate sell (kWh):...


Data:3c12a91f-c90f-4e1e-9d1e-7f1372e6b177 | Open Energy Information  

Open Energy Info (EERE)

1f-c90f-4e1e-9d1e-7f1372e6b177 1f-c90f-4e1e-9d1e-7f1372e6b177 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: CenterPoint Energy Effective date: 2013/01/25 End date if known: Rate name: Secondary Service - Greater than 10 kVa, IDR Metered, greater than 2000 kVa (TC-LOS-A) - Muni Discount Rate Sector: Commercial Description: Delivery Service will be single-phase, 60 hertz, at a standard secondary voltage. Delivery Service will be metered using Company's standard watt-hour Meter provided for this type of Delivery Service. Any other metering option(s) will be provided at an additional charge and/or will be provided by a Meter Owner other than the Company pursuant to Applicable Legal Authorities. Where Delivery Service of the type desired is not available at the Point of Delivery, additional charges and special contract arrangements may be required prior to Delivery Service being furnished, pursuant to Section, Construction Services, in this Tariff.


Universit Paris XIII U.F.R. des Lettres, des Sciences de l'Homme et des Socits  

E-Print Network (OSTI)

-rartl-mnd-iopo-iopl-mnd-hm-pr-ht-pr-hl-iop-ho-ihm-h-abdo-sopo-opo-cl Fig.4.Continued © 2011 The Authors

Paris-Sud XI, Université de


i~f~.~..!:@'i~jgI ;0"'~S'"e.~-  

E-Print Network (OSTI)

-rartl-mnd-iopo-iopl-mnd-hm-pr-ht-pr-hl-iop-ho-ihm-h-abdo-sopo-opo-cl Fig.4.Continued © 2011 The Authors

Sereno, Martin


Dynamic Modeling of Behavior Change H. T. Banks, Keri L. Rehm, Karyn L. Sutton  

E-Print Network (OSTI)

chacun des noeuds des deux documents : sds1(r) = snf 1(r) = pr tree ? p nf 1 tree + pr paper ? pnf 1


Bipolaron Model of the Superconductivity of an Iron-Based Layered Compound LnO_{1-x}F_xFePn (Ln =La, Sm, Nd, Pr, Ce, Pn=P, As)  

E-Print Network (OSTI)

A bipolaron model is proposed as a superconductivity mechanism for iron-based superconductivity. The results are consistent with the experiments.

Liang-You Zheng; Bo-Cheng Wang; Shan T. Lai



Williams College Expedition: Jay M. Pasachoff, Bryce A. Babcock, William G. Wagner, Matthew Baldwin, Katherine DuPr, Marcus Freeman, Marek Demianski, and Paul Rosenthal, in collaboration with Alphya Nestorenko and Igor  

E-Print Network (OSTI)

at the Siberian 2008 Total Solar Eclipse Jay M. Pasachoff (Caltech & Williams College), Bryce A. Babcock, Marcus Schneider (Steward Obs., U. AZ) Abstract. We successfully observed the 1 August 2008 total solar eclipse from the rooftop observatory of the State University of Novosibirsk in Aka- demgorodok, Siberia

Schneider, Glenn


energy.gov -Headquarters' Press Release (Print Version) Tuesday, February 4, 2003 http://www.energy.gov/HQPress/releases03/febpr/pr03027_v.htm Page: 1  

E-Print Network (OSTI)

of a mixed oxide (MOX) fuel fabrication facility in the U.S. and U.S. efforts to assist Russia with the start of construction of an industrial scale MOX fuel fabrication facility. Additionally, the request includes $30


September 23 and 24 2010 Organizing Committee  

Science Conference Proceedings (OSTI)

... National Renewable Energy Laboratory, Golden, CO ... Chemical Engineering, and Biotechnology, Donghua University, Shanghai 201620, PR China ...



Advanced Modularity Design for The MIT Pebble Bed Reactor  

E-Print Network (OSTI)

Consortium Annual Report", Cambridge, Massachusetts: Massachusetts Institute of Technology, MIT-ANP-PR-075



E-Print Network (OSTI)

The work reported herein was supported under the National Research and Development Centers, PR/Award

Jos Felipe Martnez; Alison L. Bailey; Deirdre Kerr; Becky H. Huang; Stacey Beauregard; Jos Felipe Martnez; Alison L. Bailey; Deirdre Kerr; Becky H. Huang; Stacey Beauregard; Jos Felipe Martnez; Alison L. Bailey; Deirdre Kerr; Becky H. Huang; Stacey Beauregard




E-Print Network (OSTI)

like to thank my supervisor, Pr. Chris Pickett, for his enthusiastic and friendly supervision during

Paris-Sud XI, Université de


rev. 9-8-09 The West Virginia University P.I. Reed School of Journalism traditionally offers  

E-Print Network (OSTI)

development, opportunities and challenges, techniques and management of public relations are included. PR 301, establishing and maintenance of web server account, uploading files. PR 401. Applied Public Relations. 3 Hr campaign for an actual client. PR 512. Fundraising and Foundation Management. 3 Hr. PR: Consent

Mohaghegh, Shahab


Lipid Oxidation Pathways, Volume 2Chapter 2 Chemistry and Reactions of Reactive Oxygen Species in Lipid Oxidation  

Science Conference Proceedings (OSTI)

Lipid Oxidation Pathways, Volume 2 Chapter 2 Chemistry and Reactions of Reactive Oxygen Species in Lipid Oxidation Health Nutrition Biochemistry eChapters Health - Nutrition - Biochemistry AC26ACB856C86AFB9EC8D10FE0DBB342 Press


Comparisons of Rain Rate and Reflectivity Factor Derived from the TRMM Precipitation Radar and the WSR-88D over the Melbourne, Florida, Site  

Science Conference Proceedings (OSTI)

Validating the results from the spaceborne Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) requires comparisons with well-calibrated ground-based radar measurements. At altitudes near the storm top, where effects of PR signal ...

Liang Liao; Robert Meneghini; Toshio Iguchi



Light-induced transcriptional responses associated with proteorhodopsin-enhanced growth in a marine flavobacterium  

E-Print Network (OSTI)

Proteorhodopsin (PR) is a photoprotein that functions as a light-driven proton pump in diverse marine Bacteria and Archaea. Recent studies have suggested that PR may enhance both growth rate and yield in some flavobacteria ...

Kimura, Hiroyuki


When crop transgenes wander in California, should we worry?  

E-Print Network (OSTI)

larvae. Nature 3999:214. [NRC] National Research Council.DC: Nat Acad Pr. 307 p. NRC. 1989. Field-testing GeneticallyDC: Nat Acad Pr. 170 p. NRC. 2000. Genetically Modi?ed Pest-

Ellstrand, Norman C.



Comparison of Rain Rates over the Ocean Derived from TRMM Microwave Imager and Precipitation Radar  

Science Conference Proceedings (OSTI)

Surface rain rates over the ocean derived from the Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI) and precipitation radar (PR) are compared and systematic differences between TMI-derived rain rates and PR-derived rain rates are ...

Junji Ikai; Kenji Nakamura



2013 Summer's End Poster Session | Princeton Plasma Physics Lab  

NLE Websites -- All DOE Office Websites (Extended Search)

View larger image 13 PR 0814 356 View larger image 13 PR 0814 378 View larger image HR 6 A 8465 W View larger image JB HR 6 A 8610 View larger image HR 6 A 8528 View larger image...


Universitt Potsdam Institut fr Physik und Astronomie  

E-Print Network (OSTI)

-/Prüfungsleistungen: schriftlicher Ergebnisbericht Literatur: Wissenschaftliche Originalliteratur #12;Modulbezeichnung Prüfungsordnung Empfohlene Voraussetzungen: Angestrebte Lernergebnisse: Fähigkeit, wissenschaftliche Entwicklungen Ergebnisbericht Literatur: #12;Modulbezeichnung: Forschungspraktikum: (1) Photonik und Quantenoptik / (2

Potsdam, Universität

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


bersicht ber evaluierte Lehrveranstaltungen und Dozierende des Fachbereichs Wirtschaftswissenschaften Seite 1 von 4 Anrede Vorname Name Anmel  

E-Print Network (OSTI)

-/Prüfungsleistungen: schriftlicher Ergebnisbericht Literatur: Wissenschaftliche Originalliteratur #12;Modulbezeichnung Prüfungsordnung Empfohlene Voraussetzungen: Angestrebte Lernergebnisse: Fähigkeit, wissenschaftliche Entwicklungen Ergebnisbericht Literatur: #12;Modulbezeichnung: Forschungspraktikum: (1) Photonik und Quantenoptik / (2

Kallenrode, May-Britt


Approximation Techniques for the Set of Efficient Points  

E-Print Network (OSTI)

-/Prüfungsleistungen: schriftlicher Ergebnisbericht Literatur: Wissenschaftliche Originalliteratur #12;Modulbezeichnung Prüfungsordnung Empfohlene Voraussetzungen: Angestrebte Lernergebnisse: Fähigkeit, wissenschaftliche Entwicklungen Ergebnisbericht Literatur: #12;Modulbezeichnung: Forschungspraktikum: (1) Photonik und Quantenoptik / (2

Fliege, Jörg


A.12a (Pre-SAS 115) Letter to communicate significant deficiencies and/or material weaknesses in internal control over financial reporting noted in an audit of financial statements of a nonpublic entity, excluding FDICIA engagements (Rev. 1/08)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

I325 8 I325 8 (8-89) EFG (07-90) United States Government Department of Energy Memorandum DATE: December 22,2009 REPLY TO A I T N OF: IG-322 (A09FN006) SUBJECT: Management Letter on the Audit of the Department of Energy's Consolidated Financial Statements for Fiscal Year 2009 TO: Chief Financial Officer, CF- 1 Attached is the subject letter prepared by KPMG LLP, our contract auditors. The letter contains 21 new findings (see letter, Exhibit A) and 5 repeat findings (see letter, Exhibit B) that were issued during the course of the Fiscal Year 2009 audit of the Department of Energy's (Department) Consolidated Financial Statements. Management generally concurred with and provided planned corrective actions for most of the recommendations listed in the Management Letter and management's comments are


Dual-use chromophores for photorefractive and irreversible photochromic applications  

E-Print Network (OSTI)

the remanence polarization P = PR rather than the depoled state P = 0. (The remanence polarization is that which

Hayden, L. Michael


Julian Szekely Memorial Symposium: Technical Program: Session 5  

Science Conference Proceedings (OSTI)

SESSION CHAIRS: P. Fauchais, University de Limoges, Limoges, France P.R. Taylor, University of Idaho, Moscow, Idaho...


Proceedings of ITC-CSCC 97 Okinawa, Japan Design of A Vita -bi Decoder  

E-Print Network (OSTI)

Proceedings of ITC-CSCC ¯97 Okinawa, Japan Design of A Vita -bi Decoder w ith Sequence- Pr ocessing

Choi, Woo-Young


Linear Algebra Notes David A. SANTOS  

E-Print Network (OSTI)

-01034 MIT-ANP-PR-075 July 2000 MIT COLLABORATORS INEEL COLLABORATORS Andrew C. Kadak David A. Petti Ronald G

California at Santa Cruz, University of


Proceedings HTR2006: International Topical Meeting on High Temperature Reactor Technology  

E-Print Network (OSTI)

" MIT ­ ANP-PR-094, December 2002 [11] Hirschfelder, "Molecular Theory of Gases and liquids", John Wiley



E-Print Network (OSTI)

Fabrice VERJUS Examinateur Président Cap-VRF Jean-Marc LAHEURTE Examinateur Professeur, Université Paris

Baudoin, Geneviève


Liebe campus-Leserinnen, liebe campus-Leser,  

E-Print Network (OSTI)

Kellenberger Präsident des IKRK. JAKOB KELLENBERGER 20% aller Kraftwerke weltweit hat ALSTOM bereits gebaut

Huber, Patrick


A Retrospective Filter Trust Region Algorithm For Unconstrained ...  

E-Print Network (OSTI)

School of Mathematics Science, Suzhou University, Suzhou 215006, PR ...... partment of Electrical Engineering and Computer Science, Northwestern Uni-.


Lizentiatsarbeit der Philosophischen Fakultt der Universitt Zrich Factors from Diffusion of Innovations  

E-Print Network (OSTI)

five years of age, mostly in developing countries (Kosek, Bern & Guerrant, 2003; Prüss, Kay, Fewtrell

Richner, Heinz


MAISON DE LA RECHERCHE Ecoles Doctorales  

E-Print Network (OSTI)

phrases Membres du jury : DANLOS Laurence PR Linguistique informatique Université Paris 7, LAPALME Guy, PR Linguistique informatique, Université de Montréal, Canada, GAGNON Michel, PR Linguistique informatique, ?cole de recherche de la linguistique informatique qui étudie la possibilité d'attribuer à une machine la

Naud Frédéric



NLE Websites -- All DOE Office Websites (Extended Search)

protein: predict length 583 protein: predict length 583 ....,....1....,....2....,....3....,....4....,....5....,....6 AA |SNGIEASLLTDPKDVSGRTVDYIIAGGGLTGLTTAARLTENPNISVLVIESGSYESDRGP| PHD | EE EEEEE HHHHHHHHHH EEEEEEEE | Rel |997411335695111464214899747355786232143699827999982898667886| detail: prH-|000000122102433211100000000366787554463100000000000000111111 prE-|001254221100011102346899720000001333321000157999985100110001 prL-|988644556787444575453100168622110112115799831000014898777886 subset: SUB |LLL.....LLLL....L....EEEE.L.HHHHH......LLLL.EEEEEE.LLLLLLLLL| ....,....7....,....8....,....9....,....10...,....11...,....1 AA |IIEDLNAYGDIFGSSVDHAYETVELATNNQTALIRSGNGLGGSTLVNGGTWTRPHKAQVD| PHD | E HHHH |


Kheshbn No. 125- Spring 1995 - Journal  

E-Print Network (OSTI)

IIK on H 711K o'B H ^ ]anp ]IK paayn ^nv 7? am ,p"nryaoKoPR ORI /|" lyr? nyn oyn anp nyi ? 03U GTR11 TDTlRll - R m (1947 pa) "Q-IR lyrpR puya anp pijn pR ,iiRp-iRa pR ,ya



Resolving arthropod relationships: Present and future insights from evo-devo studies  

E-Print Network (OSTI)

AF domain in the N-terminus of PR-B (Sartorius et al., 1994). PR-A and PR-B appear to have distinct160s are expressed in primary cultures of rat astrocytes (Grenier et al., 2006). Interestingly of the Golgi apparatus (Grenier et al., 2006). Over-expression and siRNA knockdown experiments using

Popadic', Aleksandar


A New Approach of Performance Improvement for Server Selection in Reliable Server Pooling Systems  

E-Print Network (OSTI)

. The Server Selection by PR and PU be acknowledged by the PE within a given timeout) and propagates the service of a pool given by its PH, a PU requests a PE selection from an arbitrary PR of the op- eration the list of PE identities selected by the PR into its local cache (denoted as PU-side cache). From

Dreibholz, Thomas



E-Print Network (OSTI)

BEAUREGARD, PR, Université de Toulouse Le Mirail (rapporteur) M. Jean-Gérard LAPACHERIE, PR, Université de, Université de Saragosse (rapporteur) Mme Raphaëlle COSTA DE BEAUREGARD, PR, Université de Toulouse Le Mirail

Paris-Sud XI, Université de


Prion Protein is Expressed on Long-term Repopulating Hematopoietic Stem Cells and is Necessary for their Self-renewal  

E-Print Network (OSTI)

We show that the prion protein (PrP) is expressed on the surface of bone marrow cell populations enriched in long-term repopulating hematopoietic stem cells. Affinity purification of the PrP-positive and PrP-negative ...

Lodish, Harvey F.


Summary of the planning, management, and evaluation process for the Geothermal Program Review VI conference  

DOE Green Energy (OSTI)

The purpose of this document is to present an overview of the planning, facilitation, and evaluation process used to conduct the Geothermal Program Review VI (PR VI) conference. This document was also prepared to highlight lessons learned from PR VI and, by utilizing the evaluation summaries and recommendations, be used as a planning tool for PR VII. The conference, entitled Beyond Goals and Objectives,'' was sponsored by the US Department of Energy's (DOE) Geothermal Technology Division (GTD), PR VI was held in San Francisco, California on April 19--21, 1988 and was attended by 127 participants. PR VI was held in conjunction with the National Geothermal Association's (NGA) Industry Round Table. This document presents a brief summary of the activities, responsibilities, and resources for implementing the PR VI meeting and provides recommendations, checklists, and a proposed schedule for assisting in planning PR VII.

Not Available


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


PR10-112508 C A L I F O R N I A E N V I R O N M E N T A L P R O T E C T I O N A G E N C Y  

E-Print Network (OSTI)

California's precious resources, protecting and enhancing our environment, and building public-private


Ausgabe 3 2007/2008 Jahrgang 52 6. Dezember 2007www.hu-berlin.de/pr/zeitung HUMBOLDTD i e Z e i t u n g d e r A l m a M a t e r B e r o l i n e n s i s  

E-Print Network (OSTI)

- kollegien sind auch elf Wissenschaftler der HU: Prof. Dr. Ernst Osterkamp, Neu- ere deutsche Literatur; Prof. Elmar Kulke, Humangeographie. Red. Alexander-von-Humboldt- Stipendiat in der Chemie Seit dem 1. Februar 2008 forscht Dr. Fawzi Mohamed am Institut für Chemie, Arbeitsgruppe Theoretische Chemie und

Röder, Beate


Precision Microcomb Design and Fabrication for Constellation-X Spectroscopy X-ray Telescope Assembly  

E-Print Network (OSTI)

m ·Monolithic shells: ·13~76 mm thick ·Angular resolution: 0.5´´ ·Limited collection area and heavy; Quartz(b) Contact print thick Photoresist (PR); (e) Strip PR, BOE, Extract finished microcomb; (c) Dry Photoresist Profile #12;PR SiO2 Silicon · SEM for Silicon oxide profile after BOE, 70 degree of sidewall angle


Biogeography and conservation in Southeast Asia: how 2.7 million years of repeated environmental fluctuations affect todays patterns and the future of the remaining refugial-phase biodiversity  

E-Print Network (OSTI)

AB, Konstant WR, Flick P, Pilgrim J, Old?eld S, Magin G,RA, Gil PR, Hoffman M, Pilgrim J, Brooks T, Mittermeier CG,

Woodruff, David S.



From White Kitchens to White Factories: The Impact of World War I on African-American Working Women in Chicago  

E-Print Network (OSTI)

diary or 'travellogue. ' "Pilgrim' s Progress in a Laundry,"are corroborated in "Pilgrim's PrPilgrim is a pseudonym for a college

Taylor, Ula Yvette




E-Print Network (OSTI)

.pone.0002502. #12;N. Rajakaruna and R.S. Boyd2009 7 Mittermeier, R.A., P.R. Gil, M. Hoffman, J. Pilgrim, T

Kelly, John J.



E-Print Network (OSTI)

Doctorale de Physique et d'Astrophysique (PHAST) présentée et soutenue publiquement le 28 septembre 2012 par



E-Print Network (OSTI)

Lyon Spécialité : Physique Laboratoire de Physique de l'ENS Lyon ?cole doctorale PHAST présentée et


d'ordre : 259-2009 Anne 2009 Influence des dfauts sur les proprits  

E-Print Network (OSTI)

LYON Discipline : Physique préparée au laboratoire de Physique dans le cadre de l'?cole Doctorale PHAST


Quadridirectional mode expansion modeling in integrated optics  

E-Print Network (OSTI)

.6 0.8 1 [µm] PR,T PR P T 1-P R -P T BEP, b.c. E y = 0 x [-4, 2] µm, 60 modes (QUEP, BEP Ey = 0 b,T PR P T 1-P R -P T QUEP BEP, b.c. E y = 0 x [-4, 2] µm, 60 modes (QUEP, BEP Ey = 0 b.c.), z [-1,T PR P T 1-P R -P T QUEP BEP, PML b.c.* x [-4, 2] µm, 60 modes (QUEP, BEP Ey = 0 b.c.), z [-1.8, 10

Al Hanbali, Ahmad


Treatment of Heavy Metal Wastes II - TMS  

Science Conference Proceedings (OSTI)

Session Chairs: P.R. Khangaonkar, School of Materials and Minerals Engineering, Universiti Sains Malaysia, Perak Campus, Tronoh 31750, Malaysia; Co-chair:...


1 of 3  

Science Conference Proceedings (OSTI)

... Policies are high-level statements; our organization would ... this level of work Replace 'policy' with 'standard ... 16 Xcel Energy Elizabeth Mairs T 21 PR ...



Dataplot Commands  

Science Conference Proceedings (OSTI)

... OIL.DP, PR-FI Prog to max. oil production (Simplex Method). ... USA.DAT, MP-FI Map coordinates for USA (crude resolu.) (Map). ...



PowerPoint Presentation  

NLE Websites -- All DOE Office Websites (Extended Search)

Radius (um) Temperature (degree Celsius) Case 2 Heavy pollution Typical summer monsoon rain belt TMI Rainfall PR Rainfall Area Rainnon-Rain Discrepancy RH Cloud top T A...


J. Math. Anal. Appl. 372 (2010) 208223 Contents lists available at ScienceDirect  

E-Print Network (OSTI)

a School of Mathematical Sciences, Fudan University Shanghai, PR China, 200433 b Department of Mathematics the spread of infectious diseases: pharmaceu- tical interventions (drugs, vaccines) and non

Arino, Julien


For scars, use the following table which is based upon the ...  

Science Conference Proceedings (OSTI)

... Nose MISS N0SE Pancreas MISS PANCR Missing Penis MISS PENIS Prostate Gland MISS PR0ST Arm, right MISS R ARM Ear, right MISS R EAR ...



Illinois | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

| Photo Courtesy of Audra Capas, 5StarPR Argonne Lab's Breakthrough Cathode Technology Powers Electric Vehicles of Today Jeff Chamberlain, who leads Argonne's Energy Storage...


Deep Frying: Chemistry, Nutrition and Practical ApplicationsChapter 15 Practical Foodservice Frying: Troubleshooting  

Science Conference Proceedings (OSTI)

Deep Frying: Chemistry, Nutrition and Practical Applications Chapter 15 Practical Foodservice Frying: Troubleshooting Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr


Solar Thermal Process Heat | Open Energy Information  

Open Energy Info (EERE)

Process Heat Jump to: navigation, search TODO: Add description List of Solar Thermal Process Heat Incentives Retrieved from "http:en.openei.orgwindex.php?titleSolarThermalPr...


Spezialmodul 3. Semesterdrittel WS 2012/2013 Vorlesungsnummern: 190 192 (Blockpraktikum), 190 193 (Seminar)  

E-Print Network (OSTI)

Prüfungstermine. Verbindliche Literatur : Wirth CJ (Hrsg): Praxis der Orthopädie in 2 Bänden, 3., völlig neu

Kück, Ulrich

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Science Conference Proceedings (OSTI)

Session Chairpersons: P.R. Taylor, University of Idaho, Dept. of Metallurgical & Mining Engineering, Moscow, ID 83844-3024; J.R. Groza, Chemical Engineering


Alkane Energy Plc | Open Energy Information  

Open Energy Info (EERE)

Kingdom Zip NG21 9PR Sector Services Product Designs, builds, operates and services methane treatment and generation plants. Coordinates 53.145962, -1.00554 Loading map......


Listes sujets Sujet 1 : Suivi multi-ux d'objets mobiles  

E-Print Network (OSTI)

A QA érire de nouvelles versions optimisées du préEtritement @QER seminesA RA vlider l9pprohe sur des

Noé, Laurent


Flexible finite-element modeling of global geomagnetic depth sounding  

E-Print Network (OSTI)

Modeling in 2D and 3D for Geomagnetic Depth Sounding (31, 16610. Banks, R. , 1969: Geomagnetic variations and the1997: Introduction to geomagnetic fields. Cambridge Univ Pr.

Ribaudo, Joseph Thomas



Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

to Notice of Inquiry ("NOI") Concerning Preparation of a Report to Congress on the Price Anderson Act http:energy.govgcdownloadscomment-notice-inquiry-noi-concerning-pr...


NREL: Energy Storage - Publications and Presentations  

NLE Websites -- All DOE Office Websites (Extended Search)

Office Annual Merit Review & Peer Evaluation Meeting, Arlington, VA; May 14, 2013. NREL Report No. PR-5400-58277. Progress of the Computer-Aided Engineering of Electric...


FEMA Public Assistance Funded Projects Detail | Data.gov  

NLE Websites -- All DOE Office Websites (Extended Search)

christopher.shoup@dhs.gov Unique Identifier DHS-2539 Public Access Level public Data Dictionary Data Download URL http:www.fema.govdatasetsdata.gov.FEMAPublicAssistanceFundedPr...


2005 State Laboratory Program Workload Survey  

Science Conference Proceedings (OSTI)

Page 1. 2005 State Laboratory Program Workload Survey Summary Graphs and Data by NCSLI Legal Metrology Committee FL PR Jun'05 Rev 1 ...



2003 State Laboratory Program Workload Survey  

Science Conference Proceedings (OSTI)

Page 1. 2003 State Laboratory Program Workload Survey Summary Graphs and Data by NCWM Metrology Subcommittee FL PR Aug'03 Rev 2 ...



Wave propagation in an anisotropic metamaterial with single ...  

Science Conference Proceedings (OSTI)

Department of Physics, Nanjing University, Nanjing 210008, P.R. China. Received: 30 June ... 1. Introduction. In classical electrodynamics, it is well known that.


Weatherization & Intergovernmental Program: Projects  

NLE Websites -- All DOE Office Websites (Extended Search)

Program and the Energy Efficiency and Conservation Block Grant Program. AS GU MP PR VI State: Select one... Alaska Alabama Arkansas American Samoa Arizona California Colorado...


Cast Structure and Mechanical Properties of Fine Grained ...  

Science Conference Proceedings (OSTI)

2Beijing General Research Institute for Non-Ferrous Metals, Beijing 100088, P.R. of China. 3Department of Mechanical Engineering, Xi?an Petroleum Institute,...


Check for Chirality in Nuclear Physics  

SciTech Connect

Exited states in 134Pr were populated in the fusion-evaporation reaction 119Sn(19F, 4n)134Pr. Recoil distance Doppler-shift and Doppler-shift attenuation measurements using the Euroball spectrometer, in conjunction with the inner BGO ball and the Cologne plunger, were performed at beam energies of 87 MeV and 83 MeV, respectively. Reduced transition probabilities in 134Pr are compared to the predictions of the two quasiparticle+triaxial rotor and interacting boson fermion-fermion models. Both experimental results and theoretical calculations support only within a dynamical context the presence of intrinsic chirality in 134Pr.

Tonev, D. [INFN - Laboratori Nazionali di Legnaro, Viale dell' Universita 2, 35020 Legnaro (PD) (Italy); Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); De Angelis, G.; Gadea, A.; Marginean, N.; Napoli, D. R. [INFN-- Laboratori Nazionali di Legnaro, Viale dell' Universita 2, 35020 Legnaro (PD) (Italy); Petkov, P. [Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Dewald, A.; Pejovic, P.; Fitzler, A.; Moeller, O.; Zell, K. O. [Institut fuer Kernphysik der Universitaet zu Koeln, D-50937 Cologne (Germany); Brant, S. [Department of Physics, Faculty of Science, University of Zagreb, 10000 Zagreb (Croatia); Frauendorf, S. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Zhong, Q. [Department of Nuclear Physics, China Institute of Atomic Energy, Beijing 102413 (China); Balabanski, D. [Dipartimento di Fisica, Universita di Camerino, I-62032 Camerino (Italy); Institute for Nuclear Research and Nuclear Energy, BAS, 1784 Sofia (Bulgaria); Bazzacco, D.; Lenzi, S.; Lunardi, S. [Dipartimento di Fisica dell' Universita, 35131 Padova (Italy); INFN, Sezione di Padova, 35131 Padova (Italy); Zhang Jingye [Department of Physics and Astronomy, University of Tennessee, Knoxville, TN 37996 (United States); Zhang, Y. H. [Institute of Modern Phisics, Chinese Academy of Sciences, Lanzhou 73000 (China)



Physiological effects of heterologous expression of proteorhodopsin photosystems  

E-Print Network (OSTI)

Proteorhodopsin (PR) phototrophy plays an important role in the marine ecosystem, harvesting energy from sunlight for a diverse community of hetertrophic organisms. The simple proteorhodopsin photosystem (PRPS) composed ...

Buck, Justin David



NREL: Energy Analysis - Debbie Brodt-Giles  

NLE Websites -- All DOE Office Websites (Extended Search)

Vehicles, Diesel Exhaust Fluid, and Selective Catalytic Reduction Technologies on the AFDC (Presentation). 13 pp.; NREL Report No. PR-540-43803. Brodt-Giles, D. (2007). Biodiesel...


NETL F 451.1-1/1 Categorical Exclusion (CX) Designation Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NETLSOD FE DS092910, PR 11FE000189 OIBOSite Operations Division 2011 Gregg Sawl March - April 2011 NETL PGH: South Park Township, PA Installation of Impalement Protection Over...


Feasibility of Achieving a Zero-Net-Energy, Zero-Net-Cost Homes  

E-Print Network (OSTI)

CostCalculator"[fordishwashers] Excelworksheet. index.cfm? c=dishwash.pr_dishwashers>. File isdishwasher; clotheswasher

Al-Beaini, S.



Assessment of China's Energy-Saving and Emission-Reduction Accomplishments and Opportunities During the 11th Five Year Plan  

E-Print Network (OSTI)

htm Energy Star, 2009. Dishwashers for Consumers. Availableindex.cfm? c=dishwash.pr_dishwashers Ericsson, K. , 2006certified products such as dishwashers, refrigerators and

Levine, Mark D.




Science Conference Proceedings (OSTI)

Recent discoveries of compact (sizes {approx}rate M-dot{sub PR}{approx}10{sup 8} g s{sup -1} and higher, scaling quadratically with WD effective temperature. We compare our results with observations and show that, as expected, no WD hosting a particulate debris disk shows evidence of metal accretion rate below that produced by the PR drag. Existence of WDs accreting metals at rates significantly higher than M-dot{sub PR} suggests that another mechanism in addition to the PR drag drives accretion of high-Z elements in these systems.

Rafikov, Roman R., E-mail: rrr@astro.princeton.edu [Department of Astrophysical Sciences, Princeton University, Ivy Lane, Princeton, NJ 08540 (United States)



Cyclic electron flow under saturating excitation of dark-adapted Arabidopsis leaves  

E-Print Network (OSTI)

the wavelength of the light source (450 nm light emitting diode Luxeon LXK2-PR14-Q00 filtered through 1 mm thick

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Fermilab Today  

NLE Websites -- All DOE Office Websites (Extended Search)

us the scoop. The flags are: Argentina, Brazil, Canada, Columbia, France, Germany, Greece, India, Israel, Italy, Japan, Mexico, Netherlands, P.R. of China, Poland, Russian...


Superalloys 2008 Final Program.indd  

Science Conference Proceedings (OSTI)

Sep 18, 2008 ... Michael Gigliotti2; P.R. Subramanian2; 1Institute for Metals ... Bhowal1; Darryl Stolz1; Agnieszka Wusatowska-Sarnek1; Rick Montero1;.


Education Professional Experience Visiting Positions ...  

Science Conference Proceedings (OSTI)

... 4. PR Garabedian and GB McFadden, Design of the DEMO fusion reactor following ITER, Journal of Research of the National Institute of Standards ...




Science Conference Proceedings (OSTI)

... PR Garabedian and GB McFadden, Design of the DEMO fusion reactor following ITER, Journal of Research of the National Institute of Standards ...



Carbon Capital: The Political Ecology of Carbon Forestry and Development in Chiapas, Mexico  

E-Print Network (OSTI)

and Teaching of Economics, Mexico. AMBIO. 2008. Scolel Teeds. X. Solano & A. Cal. Mexico City: Camara de Diputadosmodern Chiapas. Univ of New Mexico Pr. Birchfield, V. (1999)

Osborne, Tracey Muttoo



A Cutting Plane Algorithm for Large Scale Semidefinite Relaxations  

E-Print Network (OSTI)

Oct 10, 2001 ... pr o gramm i ng , s p ect ral b undle m et h o d , s u b grad ie n t m et h o d ... b y so lv i ng se v e ral larg e sc ale, un st ru ct ur e d 0 -1 li n e ar pr...


Journal of Process Control 22 (2012) 809822 Contents lists available at SciVerse ScienceDirect  

E-Print Network (OSTI)

by a classical valve equation [24] wout = Coutu m(pr,t - ps) The density of the mixture m is assumed constant,in - Coutu l(x2 - ps) (7) with a = RT MVeb , b = lRT M , c = g sin ? A , ml = lVr - ml,still (8) pr,t = x2


Citation: W.-M. Yao  

NLE Websites -- All DOE Office Websites (Extended Search)

al. NELSON 03 PRL 90 021601 D. Nelson, G.T. Fleming, G.W. Kilcup ALIKHAN 02 PR D65 054505 A. Ali Khan et al. (CP-PACS Collab.) Also PR D67 059901 (erratum) A. Ali Khan et al....


Nichtamtliche Lesefassung beinhaltet die nderungen der 1. nderungssatzung zur Prfungsordnung vom  

E-Print Network (OSTI)

) Die Lehrveranstaltungen werden in Englisch oder Deutsch abgehalten. Stu- dien- und Prüfungsleistungen sind in der von den jeweiligen Prüfern festge- setzten Sprache in Deutsch oder Englisch zu erbringen. (7) Bei ausländischen Bewerbern kann bei der Immatrikulation auf Deutsch- kenntnisse gemä? der

Greifswald, Ernst-Moritz-Arndt-Universität


Prfungsordnung fr den Masterstudiengang  

E-Print Network (OSTI)

werden in Englisch oder Deutsch abgehalten. Stu- dien- und Prüfungsleistungen sind in der von den jeweiligen Prüfern festge- setzten Sprache in Deutsch oder Englisch zu erbringen. (7) Bei ausländischen Bewerbern kann bei der Immatrikulation auf Deutsch- kenntnisse gemä? der "Deutschen Sprachprüfung für den

Greifswald, Ernst-Moritz-Arndt-Universität


2452 2013 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheimwileyonlinelibrary.com full papers  

E-Print Network (OSTI)

production.[4] The emergence of nanotechnology has opened up new ways to utilize renewable energy resources for Nanoscience and Technology 11 Zhongguancun Beiyitiao Beijing 100190, PR China E-mail: gongjr@nanoctr.cn H. Wang, Prof. R. Zhang School of Chemistry Beijing Institute of Technology Beijing 100081, PR China E

Gong, Jian Ru


Neuroscience Letters 418 (2007) 227231 Chronic morphine exposure alters the dendritic morphology  

E-Print Network (OSTI)

and Technology of China, Hefei, Anhui 230027, PR China b Department of Cell biology, Anhui University, Hefei, Anhui 230039, PR China Received 15 December 2006; received in revised form 29 January 2007; accepted 10 March 2007 Abstract Repeated treatment of psychotropic drugs produces changes in brain and behavior

Zhou, Yi-Feng


Research Report Chronic morphine exposure affects the visual response properties  

E-Print Network (OSTI)

and Technology of China, Hefei, Anhui 230027, P.R. China b State Key Laboratory of Brain and Cognitive Science, Institute of Biophysics, Chinese Academy of Science, Beijing 100101, P.R. China Accepted 18 August 2005-like drugs decreased visual sensitivity in humans [41], and affected visual discrimination performance

Zhou, Yi-Feng


" ! $#&%(')' 10 123 415 6 !15 % ...  

Science Conference Proceedings (OSTI)

... p sTSVhpS FPR6 pTSs SVUdSVvVphpPRv `iPdw URS w SVhWYpw hb S&PR6 pTSs Pdw Q w PdpPdwQ w ...



Kheshbn No. 123- Spring 1994 - Journal  

E-Print Network (OSTI)

pia vpp ^a n OTp'onp ORH ny ,(anp oTPiyopRiRD lupaia m lytoyn r r a Dxyrnysra 1922 pR .anp-D^yn psny ps maanp-nnto armOW ,pp pyiiR oaytoya i n anp , p m pR pnayaa'ra a v pun



Kheshbn No. 139 - Spring 2002 - Journal  

E-Print Network (OSTI)

^Kn H m :"iix 1KA paiaya anp . ^Kiiyaac-nyan ayn PK TK 711 .T * TANTJYA 7 7 5 T IDJ*3*ANP pNiiju PN IWBN PN .1*7131TNDOAyn yTR pyV ,pyV TynaiR n pK anp pR p>Raya PR JRO TR pm ,o"



Convex Upper and Lower Bounds for Present Value Functions  

E-Print Network (OSTI)

In this paper wepr t an e#cient methodologyfor appr ximating the distrHS function of the net pr t value of a ser of cash-flows, when the discounting is pr ted by a stochastic di#erH tial equation as in the Vasicek model and in the Ho-Lee model.

D. Vyncke; M. Goovaerts; J. Dhaene



Hochschulbibliografie 2008 Hochschulbibliografie  

E-Print Network (OSTI)

, (Hrsg.): Prävention im 20. Jahrhundert. Historische Grundlagen und zukünftige Entwicklung. Weinheim 2002Eckart, Wolfgang Uwe: Geschichte der Medizin. 3. Aufl., Berlin, 1998 Huch R. (Hrsg.): Mensch, Körper gesundheitliche Aufklärung (BZgA) (Hrsg) (2011). Leitbegriffe der Gesundheitsförderung und Prävention. Glossar zu

Manstein, Dietmar J.


Modul: 2 Modultitel: Grundlagen der Prvention und Gesundheitsfrderung Modulverantwortlicher: Prof. Dr. Ulla Walter  

E-Print Network (OSTI)

gesundheitliche Aufklärung (BZgA) (Hrsg) (2011). Leitbegriffe der Gesundheitsförderung und Prävention. Glossar zu Konzepten, Strategien und Methoden. Verlag für Gesundheitsförderung: Gamburg. Schwartz FW et al. (Hrsg University Press: Oxford. Walter U, Robra BP, Schwartz FW (2012). Prävention. In: Schwartz FW et al. (Hrsg

Manstein, Dietmar J.


CNM - Proposal System  

NLE Websites -- All DOE Office Websites (Extended Search)

CN NM M - - P Pr ro op po os sa all S Sy ys st te em m P Pr ro op po os sa all P Po olliic cy y | F FA AQ Qs s | L Lo og go ou ut t | Your badge number appears on the back of your...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Faculty of Medicine (Graduate) Programs, Courses and University Regulations  

E-Print Network (OSTI)

'ai créée par la suite. Partie II : Le Présent, présente une synthèse des travaux de recherche réalisés dans .................................................................................................................. 70 PARTIE II : LE PRESENT

Fabry, Frederic


Preprint to appear in J. Computational Biology, 2007. Hypergraph Model of Multi-residue Interactions in  

E-Print Network (OSTI)

of sparse data sets proposed by Sippl (Sippl, 1990): qe(R) = 1 · p(R) + 2 · pe(R) , (3) but employing that determines the relative contributions of database and family. Note that when = 0, qe(R) = p(R) and the family-specific information is ignored; whereas when = , qe(R) = pe(R) and the database information

Bailey-Kellogg, Chris



E-Print Network (OSTI)

CORSE M. BALBI JACQUES-HENRI PR, DIR. LAB. UMR CNRS 6134, U.DE CORSE M. LOUCHE ALAIN PR, U. DE CORSE M-Henri BALBI (Université de Corse) et Alain LOUCHE (Université de Corse) pour leur participation à cette

Paris-Sud XI, Université de


A New Server Selection Strategy for Reliable Server Pooling in Widely Distributed Environments  

E-Print Network (OSTI)

Selection by PR and PU ing to up-to-date application-specific load information. Round robin selection,7,8]. The PU writes the list of PE identities selected by the PR into its local cache (denoted as PU-side cache). From this cache, the PU selects ­ again using the pool's policy ­ one element to contact

Dreibholz, Thomas


Activation of white phosphorus by molybdenum- and uranium tris-amides  

E-Print Network (OSTI)

Molybdaziridine-hydride Mo(H)([eta]-Me?C=NAr)(N[i-Pr]Ar)? (1, Ar = 3,5-C?H?Me?) acts as a source of its three-coordinate isomer Mo(N[i-Pr]Ar)? (2). This relationship has been probed via an investigation of the coordination ...

Stephens, Frances H. (Frances Helen), 1977-




E-Print Network (OSTI)

battery-cracking site in situ using a phosphate additive costs as little as $55 Mg-1 soil (Showdhury et al and kinetics of reactions between PR and soils. Our results demonstrate that PR has a potential to cost sample, obtained from a former battery-cracking site in Florida, had Pb concentra- tions up to 135 000 mg

Ma, Lena


Can a computer learn to choose movies you're sure  

E-Print Network (OSTI)

for the million-dollar grand prize. ENGINEERING & SCIENCE s pr i ng 201032 Many a Caltech PhD goes into research Caltech professor Yaser Abu-Mostafa [PhD '83] has aptly described as the Super Bowl of machine learning., Copyright © 2010 Netflix, Inc. All rights reserved. #12;s pr i ng 2010 ENGINEERING & SCIENCE 33 course. I



E-Print Network (OSTI)

variations in the search parameters ?1 and ?2 affect C1 and C2, respectively. 3.2. ..... movements move(u, v) for all v ? D and performs the best one in terms of .... this latter application of PR are considered to be candidates to enter ES, and PR.


Puerariae radix isoflavones and their metabolites inhibit growth and induce apoptosis in breast cancer cells  

SciTech Connect

Puerariae radix (PR) is a popular natural herb and a traditional food in Asia, which has antithrombotic and anti-allergic properties and stimulates estrogenic activity. In the present study, we investigated the effects of the PR isoflavones puerarin, daidzein, and genistein on the growth of breast cancer cells. Our data revealed that after treatment with PR isoflavones, a dose-dependent inhibition of cell growth occurred in HS578T, MDA-MB-231, and MCF-7 cell lines. Results from cell cycle distribution and apoptosis assays revealed that PR isoflavones induced cell apoptosis through a caspase-3-dependent pathway and mediated cell cycle arrest in the G2/M phase. Furthermore, we observed that the serum metabolites of PR (daidzein sulfates/glucuronides) inhibited proliferation of the breast cancer cells at a 50% cell growth inhibition (GI{sub 50}) concentration of 2.35 {mu}M. These results indicate that the daidzein constituent of PR can be metabolized to daidzein sulfates or daidzein glucuronides that exhibit anticancer activities. The protein expression levels of the active forms of caspase-9 and Bax in breast cancer cells were significantly increased by treatment with PR metabolites. These metabolites also increased the protein expression levels of p53 and p21. We therefore suggest that PR may act as a chemopreventive and/or chemotherapeutic agent against breast cancer by reducing cell viability and inducing apoptosis.

Lin, Y.-J. [Department of Medical Genetics and Medical Research, China Medical University Hospital, No. 2 Yuh-Der Road, Taichung, Taiwan (China); Department of Biotechnology, Asia University, Taichung, Taiwan (China); Graduate Institute of Chinese Medical Science, China Medical University, Taichung, Taiwan (China); Hou, Y.C. [School of Pharmacy, China Medical University, Taichung, Taiwan (China); Lin, C.-H.; Hsu, Y.-A. [Department of Life Science, National Tsing Hua University, HsinChu, Taiwan (China); Sheu, Jim J.C. [Graduate Institute of Chinese Medical Science, China Medical University, Taichung, Taiwan (China); Lai, C.-H. [Department of Microbiology, School of Medicine, China Medical University, Taichung, Taiwan (China); Chen, B.-H. [Faculty of Biotechnology, Kaohsiung Medical University, Kaohsiung, Taiwan (China); Lee Chao, Pei-Dawn [School of Pharmacy, China Medical University, Taichung, Taiwan (China); Wan Lei [Department of Medical Genetics and Medical Research, China Medical University Hospital, No. 2 Yuh-Der Road, Taichung, Taiwan (China); Department of Biotechnology, Asia University, Taichung, Taiwan (China); Graduate Institute of Chinese Medical Science, China Medical University, Taichung, Taiwan (China)], E-mail: leiwan@mail.cmuh.org.tw; Tsai, F.-J. [Department of Medical Genetics and Medical Research, China Medical University Hospital, No. 2 Yuh-Der Road, Taichung, Taiwan (China); Department of Biotechnology, Asia University, Taichung, Taiwan (China); Graduate Institute of Chinese Medical Science, China Medical University, Taichung, Taiwan (China)], E-mail: d0704@mail.cmuh.org.tw



Physics 214 Winter 2013 The Poisson equation and the inverse Laplacian  

E-Print Network (OSTI)

and its solution We wish to solve the Poisson equation, 2 = -4 , (1) given a known charge distribution (r surface). The solution will take the form, (r) = p(r) + c(r) , (2) where p(r) is a particular solution to the Poisson equation and c(r) is the (comple- mentary) solution to the Laplace equation, 2 c(r) = 0

California at Santa Cruz, University of


Kheshbn No. 128- Fall 1996 - Journal  

E-Print Network (OSTI)

OPTO ORI ,pin nutro DuaV **VR OIO VOTO PR yoRo lypnoTOni 15*n* S* oipi pVan ]IK nAo p ty oio ayo -yoam yxnp n pR ,nvipORH o^payVpim yoRPiia H m ,oio M .py " m TR o'ui ima oiV-|



tr s s t t tt tr rst r  

E-Print Network (OSTI)

tr s s ût t tt Pr tr r tr rsté r s s tt r r rs r sts s s s s ssr r s és ès st qt à t r sé Pr rs ts r rtr Pr rçs rsté rss rtr Pr rçs rs st s r tr Pr ré rsté r r tr r Ps r rtr tès r s ss ût tt s r r té tel-00764952,version1-13Dec2012 #12;R t s ré tt q

Paris-Sud XI, Université de


Caught in the Act: The 1.5 Resolution Crystal Structures of the HIV-1 Protease and the I54V Mutant Reveal a Tetrahedral Reaction Intermediate  

DOE Green Energy (OSTI)

HIV-1 protease (PR) is the target for several important antiviral drugs used in AIDS therapy. The drugs bind inside the active site cavity of PR where normally the viral polyprotein substrate is bound and hydrolyzed. We report two high-resolution crystal structures of wild-type PR (PR{sub WT}) and the multi-drug-resistant variant with the I54V mutation (PR{sub I54V}) in complex with a peptide at 1.46 and 1.50 {angstrom} resolution, respectively. The peptide forms a gem-diol tetrahedral reaction intermediate (TI) in the crystal structures. Distinctive interactions are observed for the TI binding in the active site cavity of PR{sub WT} and PR{sub I54V}. The mutant PR{sub I54V}/TI complex has lost water-mediated hydrogen bond interactions with the amides of Ile50 and Ile50{prime} in the flap. Hence, the structures provide insight into the mechanism of drug resistance arising from this mutation. The structures also illustrate an intermediate state in the hydrolysis reaction. One of the gem-diol hydroxide groups in the PR{sub WT} complex forms a very short (2.3 {angstrom}) hydrogen bond with the outer carboxylate oxygen of Asp25. Quantum chemical calculations based on this TI structure are consistent with protonation of the inner carboxylate oxygen of Asp25{prime}, in contrast to several theoretical studies. These TI complexes and quantum calculations are discussed in relation to the chemical mechanism of the peptide bond hydrolysis catalyzed by PR.

Kovalevsky, Andrey Y.; Chumanevich, Alexander A.; Liu, Fengling; Louis, John M.; Weber, Irene T. (GSU)



Optical amplification at the 1. 31 wavelength  

DOE Patents (OSTI)

An optical amplifier operating at the 1.31 [mu]m wavelength for use in such applications as telecommunications, cable television, and computer systems is described. An optical fiber or other waveguide device is doped with both Tm[sup 3+] and Pr[sup 3+] ions. When pumped by a diode laser operating at a wavelength of 785 nm, energy is transferred from the Tm[sup 3+] ions to the Pr[sup 3+] ions, causing the Pr[sup 3+] ions to amplify at a wavelength of 1.31. 1 figure.

Cockroft, N.J.



Optical amplification at the 1.31 wavelength  

DOE Patents (OSTI)

An optical amplifier operating at the 1.31 .mu.m wavelength for use in such applications as telecommunications, cable television, and computer systems. An optical fiber or other waveguide device is doped with both Tm.sup.3+ and Pr.sup.3+ ions. When pumped by a diode laser operating at a wavelength of 785 nm, energy is transferred from the Tm.sup.3+ ions to the Pr.sup.3+ ions, causing the Pr.sup.3+ ions to amplify at a wavelength of 1.31

Cockroft, Nigel J. (Los Alamos, NM)



C NMR Spectra (see p S10)  

E-Print Network (OSTI)

S31 1 H and 13 C NMR Spectra (see p S10) NHBn Me Ph 10 #12;S32 1 H and 13 C NMR Spectra (see p S10) NHBn Me Ph 11 #12;S33 1 H and 13 C NMR Spectra (see p S11) NH-i-Pr n-Bu NH-i-Pr n-Bu 12 Me Me 13 #12;S34 1 H and 13 C NMR Spectra (see p S11)NH-i-Pr Me Ph 14 #12;S35 1 H and 13 C NMR Spectra (see p S11

Collum, David B.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

B-1 B-1 APPENDIX B RELATED INTERNET WEB SITES WHERE CAN I ACCESS ELECTRONIC COPIES OF REFERENCES LISTED IN THIS REFERENCE BOOK? http://www.cfo.doe.gov/policy/actindex/index.html-ssi DOE Accounting Handbook http://www.pr.doe.gov/acqguide.html DOE Acquisition Guide http://www.pr.doe.gov//acqltr.html DOE Acquisition Letters http://www.pr.doe.gov/dear.html DOE Acquisition Regulation (DEAR) http://www.cfo.doe.gov/progliaison/bmop/index.htm DOE Business Management Oversight Process Web Page http://www.cfo.doe.gov/budget/ DOE Chief Financial Officer Budget Related Information (DOE Budget Call, Budget Formulation Handbook, Principles of Appropriation Law, etc.) http://home.doe.gov/news/releases99/junpr/pr99163.htm DOE Deputy Secretary's Memorandum, of June 25, 1999, on Project Management


Mechanical modeling and transient anti-plane fracture analysis for ...  

Science Conference Proceedings (OSTI)

Mar 13, 2008 ... Armored Force Engineering, No. 21, Du Jia Kan, Chang. Xin Dian, Beijing 100072, P.R. China e-mail: LYDbeijing@163.com. Y.-D. Li K.Y. Lee...


Prfungsordnung fr die Bachelor-und Masterstudiengnge Chemie und Molecular Science der Universitt Erlangen-Nrnberg  

E-Print Network (OSTI)

Prüfungsordnung für die Bachelor- und Masterstudiengänge Chemie und Molecular Science der) Bachelorstudium Chemie.........................................................................................13 § 27 Modulprüfungen im Grundabschnitt des Bachelorstudiums Chemie ........13 § 28 Grundlagen- und

Fiebig, Peter


Erste Satzung zur nderung der Studien-und Prfungsordnung der Universitt Stuttgart fr den Bachelorstudiengang Chemie  

E-Print Network (OSTI)

Bachelorstudiengang Chemie Vom 18. August 2009 Aufgrund von § 34 Abs. 1 Satz 3 des Landeshochschulgesetzes vom 01 Satzung zur ?nderung der Studien- und Prüfungsordnung für den Bachelorstudiengang Chemie vom 01. Oktober

Möbius, Bernd

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Four LBA-ECO Data Sets Released from the Nutrient Dynamics Teams  

NLE Websites -- All DOE Office Websites (Extended Search)

(LBA). LBA-ECO ND-02 Cation Leaching from Forest and Pasture Soils, Para, Brazil. Data set prepared by D. Markewitz, E.A. Davidson, R.D.O. Figueiredo, P.R. Moutinho and D.C....


Axiomatic Characterizations of Some Tournament Solutions  

E-Print Network (OSTI)

forming a strict preference cycle, it can be shown that every subset admits a ..... (y ,w) ? R, then combined with (y,x) ? P(R) and (y,z)?R we get y?G(A,R).Since.



E-Print Network (OSTI)

over Group VIII Metal Catalysts" J.T. Kummer and P.H.and Fischer- Iron Catalyst", to be published. P.R. Wentrek,on Alumina-supported Ruthenium Catalyst" to be published. M.

Low, Gordon Gongngai



Diacylglycerol Oil, 2nd Edition Chapter 14 Studies of Ad Libitum Ingestion of Phytosterol-Enriched Diacylglycerol Oil  

Science Conference Proceedings (OSTI)

Diacylglycerol Oil, 2nd Edition Chapter 14 Studies of Ad Libitum Ingestion of Phytosterol-Enriched Diacylglycerol Oil Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr


Effects of Nonuniform Beam Filling on Rainfall Retrieval for the TRMM Precipitation Radar  

Science Conference Proceedings (OSTI)

The Tropical Rainfall Measuring Mission (TRMM) will carry the first spaceborne radar for rainfall observation. Because the TRMM Precipitation Radar (PR) footprint size of 4.3 km is greater than the scale of some convective rainfall events, there ...

S. L. Durden; Z. S. Haddad; A. Kitiyakara; F. K. Li



A Surface Wind ModelBased Method to Estimate Rain-Induced Radar Path Attenuation over Ocean  

Science Conference Proceedings (OSTI)

The rainfall retrieved using the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) depends on estimating the radar signal path-integrated attenuation using the surface reference technique (SRT). This technique assumes uniform ...

Li Li; Eastwood Im; Stephen L. Durden; Ziad S. Haddad



Facult des arts et des sciences Dpartement de linguistique et de traduction  

E-Print Network (OSTI)

Faculté des arts et des sciences Département de linguistique et de traduction ?VALUATION DE LA vous remercions de votre précieuse collaboration au programme de stages du Département de linguistique

Parrott, Lael


Evaluation of Spatial Errors of Precipitation Rates and Types from TRMM Space-borne Radar over the southern CONUS  

Science Conference Proceedings (OSTI)

In this paper we estimate the uncertainty of the rainfall products from NASA and JAXAs Tropical Rainfall Measurement Mission (TRMM) Precipitation Radar (PR) so that they may be used in a quantitative manner for applications like hydrologic ...

S. Chen; P. E. Kirstetter; Y. Hong; J. J. Gourley; Y. D. Tian; Y. C. Qi; Q. Cao; J. Zhang; K. Howard; J. J. Hu; X. W. Xue


Rainfall Estimation from a Combination of TRMM Precipitation Radar and GOES Multispectral Satellite Imagery through the Use of an Artificial Neural Network  

Science Conference Proceedings (OSTI)

This paper describes the development of a satellite precipitation algorithm designed to generate rainfall estimates at high spatial and temporal resolutions using a combination of Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR)...

Tim Bellerby; Martin Todd; Dom Kniveton; Chris Kidd



Guidance for Planning Exercises  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

for Planning, Conducting and Evaluating for Planning, Conducting and Evaluating Transportation Emergency Preparedness Tabletops, Drills and Exercises Prepared for the Department of Energy Office of Transportation and Emergency Management 02B00215-10.p65 This page intentionally left blank table of contents Transportation Emergency Preparedness Program (TEPP) planning tools planning tools Guidance f Guidance f Guidance f Guidance f Guidance for Planning, Conducting and Ev or Planning, Conducting and Ev or Planning, Conducting and Ev or Planning, Conducting and Ev or Planning, Conducting and Evaluating aluating aluating aluating aluating T T T T Tr r r r ransportation Emer ansportation Emer ansportation Emer ansportation Emer ansportation Emergenc genc genc genc gency Pr y Pr y Pr y Pr y Prepar epar epar epar eparedness T


A Note on the Behavior of the Randomized Kaczmarz Algorithm of ...  

E-Print Network (OSTI)

5 Yi He Yuan Street, Beijing 100871, P.R. China. (ming-jiang@pku.edu.cn) .... condition number ?(A) and, in the light of [24], it might be tempting to think that it is ...


Storm Morphology and Rainfall Characteristics of TRMM Precipitation Features  

Science Conference Proceedings (OSTI)

Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR), TRMM Microwave Imager (TMI), and Visible and Infrared Scanner (VIRS) observations within the Precipitation Feature (PF) database have been analyzed to examine regional ...

Stephen W. Nesbitt; Robert Cifelli; Steven A. Rutledge



Vision Research 41 (2001) 285293 Colour constancy from temporal cues: better matches with less  

E-Print Network (OSTI)

(SpectraColorimeter, PR-650; Photo Re- search Inc., California, USA) that had previously been calibrated¨ttiger, L., Braun, D. I., Gegenfurtner, K. R., Petersen, D., Scho¨nle, P., & Sharpe, L. T. (1999). Selective

Foster, David H.


The Tropical Convective Spectrum. Part I: Archetypal Vertical Structures  

Science Conference Proceedings (OSTI)

A taxonomy of tropical convective and stratiform vertical structures is constructed through cluster analysis of 3 yr of Tropical Rainfall Measuring Mission (TRMM) warm-season (surface temperature greater than 10C) precipitation radar (PR) ...

Dennis J. Boccippio; Walter A. Petersen; Daniel J. Cecil



Elegant Report  

NLE Websites -- All DOE Office Websites (Extended Search)

LARSEN PAR K W A Y , PR O V O , UT 84606 (801) 374- 6000 connector is constructed of a brass alloy and is nickel plated for corrosion resistance. The two springs inserted into...


Awards Program Rewarding Excellence  

Science Conference Proceedings (OSTI)

AOCS awards recognize achievements and contributions to the profession, industry and society. Awards Program Rewarding Excellence Awards Program achievement aocs application award Awards baldwin distinguished division memorial nomination poster pr


The Relationship between Tropical Cyclone Intensity Change and the Strength of Inner-Core Convection  

Science Conference Proceedings (OSTI)

Convective intensity proxies measured by the Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI), Precipitation Radar (PR), and Visible and Infrared Scanner (VIRS) are used to assess the relationship between intense convection in the ...

Haiyan Jiang



Transaction # 1 ...  

Science Conference Proceedings (OSTI)

... tourism pr omises an upturn - Improved outlook in customer ... it needs at least 3m tonnes of oil equivalent by ... to convert its power plants to gas and is ...



The Political Economy of Wind Power in China  

E-Print Network (OSTI)

framework,? Energy Policy 32 (2004): ?PR China,? Global WindWind Power in China: Policy and development challenges,? Energy PolicyPolicies for Renewable Energy-the example of Chinas wind

Swanson, Ryan Landon



Improving Critical Infrastructure Cybersecurity Executive Order ...  

Science Conference Proceedings (OSTI)

... 4 RA-3 ID.RA-5: Risk responses are identified. ... 4 AC-21 PR.IP-9: Response plans (Business Continuity Plan(s), Disaster Recovery Plan(s ...


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Appendix A  

Science Conference Proceedings (OSTI)

... 21, ID.RA-5: Risk responses are identified. ... 4 AC-21. 52, PR.IP-9: Response plans (Business Continuity Plan(s), Disaster Recovery Plan(s ...



Epidemiology of subpatent Plasmodium falciparum infection: implications for detection of hotspots with imperfect diagnostics  

E-Print Network (OSTI)

elimination. PLoS Med 2012, 9:e1001165. 5. Gamage-Mendis AC,Carter R, Mendis C, De ZoysaAP, Herath PR, Mendis KN: Clustering of malaria infections




E-Print Network (OSTI)

A phylogenetic tree s for the operational taxons under analysis belongs to. the set S of unrooted trees .... sor with 512 Mbytes of RAM memory. Heuristic AG+PR...


Colloids and Surfaces A: Physicochemical and Engineering Aspects 174 (2000) 403410  

E-Print Network (OSTI)

, Peking Uni6ersity, Beijing 100871, PR China Received 3 January 2000; accepted 15 May 2000 Keywords in both theoretics and appli- cations. It is well known that many drugs are insoluble in water but soluble

Huang, Jianbin


DOI: 10.1002/chem.201002195 Diversity Through a Branched Reaction Pathway: Generation of Multicyclic  

E-Print Network (OSTI)

and the discovery of new drugs.[2] The de- velopment of efficient methods for the construction of libra- ries Engineering, Changzhou University Changzhou 213164, Jiangsu, (P.R. China) Supporting information

Fenteany, Gabriel


BioMed Central Page 1 of 2  

E-Print Network (OSTI)

of Pathogen Biology, Tongji Medical College of Huazhong University of Science and Technology, Wuhan, PR China be viewed as a major target for new drugs against HIV-1. from Frontiers of Retrovirology: Complex

Paris-Sud XI, Université de


title Brookhaven National Laboratory Photon Sciences eNews News...  

NLE Websites -- All DOE Office Websites (Extended Search)

Aminoff Prize in Crystallography to NSLS user Yigong Shi of Tsinghua University Beijing China description link http www bnl gov ps enews news php a amp t pr link guid http www...


An Expert Elicitation Based Study of the Proliferation Resistance of a Suite of Nuclear Power Plants  

Science Conference Proceedings (OSTI)

In 2008, a multi-laboratory research team completed a study evaluating the proliferation resistance (PR) characteristics of a diverse suite of four advanced nuclear reactor designs. The systems evaluated included: a light water reactor (a pressurized-water reactor), a heavy water reactor, a high temperature gas reactor (with a prismatic-block reactor core), a sodium-cooled fast reactor. The team used an expert elicitation assessment approach based on the Generation IV International Forum (GIF) Proliferation Resistance and Physical Protection (PR&PP) methodology. The team evaluated three general types of proliferation threats: 1) concealed diversion of material, 2) concealed misuse of the reactor to produce material, and 3) breakout. The evaluations took into account the intrinsic PR characteristics of each reactor and the extrinsic PR characteristics provided by generic safeguards the team considered appropriate for each reactor, based on the teams experience and available conceptual design information.

Zentner, Michael D.; Therios, Ike; Bari, Robert A.; Cheng, Lap; Yue, Meng; Wigeland, Roald; Hassberger, Jim; Boyer, Brian; Pilat, Joseph



Spontaneous generation of prion infectivity in fatal familial insomnia knock-in mice  

E-Print Network (OSTI)

A crucial tenet of the prion hypothesis is that misfolding of the prion protein (PrP) induced by mutations associated with familial prion disease is, in an otherwise normal mammalian brain, sufficient to generate the ...

Faas, Henryk


A putative new ampelovirus associated with grapevine leafroll disease  

E-Print Network (OSTI)

01660) [26], and viral helicase superfamily 1 (HEL, pfamencoded by GLRaV-Pr and -9. Helicase was the most conservedmethyltrans- ferase; HEL helicase; RdRp RNA-dependent RNA

Abou Ghanem-Sabanadzovic, N.; Sabanadzovic, S.; Uyemoto, J. K.; Golino, D.; Rowhani, A.



Observed Self-Similarity of Precipitation Regimes over the Tropical Oceans  

Science Conference Proceedings (OSTI)

A K-means clustering algorithm was used to classify Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR) scenes within 1 square patches over the tropical (15S15N) oceans. Three cluster centroids or regimes that minimize the ...

Gregory S. Elsaesser; Christian D. Kummerow; Tristan S. LEcuyer; Yukari N. Takayabu; Shoichi Shige



Browse wiki | Open Energy Information  

Open Energy Info (EERE)

+ , J.K.; Donaldson + , P.R.; Kinkley + , D.L.; Wallace + , T.L. + Document type Book + FoafPage http:scienceaccelerator.govdsalink.html?collectionCodeDOE-ECD&searchId...


Advances in Conjugated Linoleic Acid Research, Vol 2Chapter 16 Conjugated Linoleic Acids as Anticancer Nutrients: Studies In Vivo and Cellular Mechanisms  

Science Conference Proceedings (OSTI)

Advances in Conjugated Linoleic Acid Research, Vol 2 Chapter 16 Conjugated Linoleic Acids as Anticancer Nutrients: Studies In Vivo and Cellular Mechanisms Health Nutrition Biochemistry eChapters Health - Nutrition - Biochemistry AOCS Pr


Palm Oil: Production, Processing, Uses, and CharacterizationChapter 2 Breeding and Genetics of the Oil Palm  

Science Conference Proceedings (OSTI)

Palm Oil: Production, Processing, Uses, and Characterization Chapter 2 Breeding and Genetics of the Oil Palm Food Science Health Nutrition Biochemistry Processing eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr


Protein and Co-Products Division  

Science Conference Proceedings (OSTI)

Protein and Co-Products division include professionals interested in proteins and co-products from biomaterial for food, feed, and industrial applications as well as extraction, separation, purification, and characterization technologies. Protein and Co-Pr


Absolute Calibration of Jason-1 and Envisat Altimeter Ku-Band Radar Cross Sections from Cross Comparison with TRMM Precipitation Radar Measurements  

Science Conference Proceedings (OSTI)

One year of collocated, rain-free nadir Ku-band backscatter cross-section measurements from the Tropical Rainfall Mapping Mission (TRMM) precipitation radar (PR) and both Jason-1 and Envisat RA-2 altimeter measurements have been compiled to ...

N. Tran; O-Z. Zanife; B. Chapron; D. Vandemark; P. Vincent




NLE Websites -- All DOE Office Websites (Extended Search)

01 NSTAR 2001 185 G. Hohler (KARL) LOPEZCAST... 01 PL B517 339 G. Lopez Castro, A. Mariano Also NP A697 440 G. Lopez Castro, A. Mariano BECK 00 PR C61 035204 R. Beck et al....


U.S. Natural Gas Market Assessment  

U.S. Energy Information Administration (EIA)

T?his has raised concerns about the availability of natural gas for next winter which is reflected in todays average spot gas pr\\?ce levels.


Alton E. Bailey Award  

Science Conference Proceedings (OSTI)

Recognizes outstanding research and exceptional service in the field of lipids and associated products Alton E. Bailey Award USA Section Alton E.Bailey award aocs awards fats global Hans Kaunitz award inform job listings member membership network oils Pr


Deep Frying: Chemistry, Nutrition and Practical ApplicationsChapter 19 Evaluation of Passive and Active Filter Media  

Science Conference Proceedings (OSTI)

Deep Frying: Chemistry, Nutrition and Practical Applications Chapter 19 Evaluation of Passive and Active Filter Media Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Postscript - CECM  

E-Print Network (OSTI)

0 a m sommets, elle peut ^etre cod ee par un couple. (A. 0. 0;S) o u .... Par application du codage de Pr ufer, on sait que ces arborescences sont cod ees par des.



E-Print Network (OSTI)

8PR = Rate of thermal input to power plant receiver (MWt)the solar thermal inputs to the daytime power plant and theof solar thermal inputs to the daytime power plant and the

Dayan, J.




E-Print Network (OSTI)

, F...ii..VRf OF YOU::! BE R:ECE1vED AT -HE c. ;CE ::5 ;:):N...""ED .~ T;..;E REI~f:>- 0:: OFFERS PR


Rainfall-Induced Changes in Actual Surface Backscattering Cross Sections and Effects on Rain-Rate Estimates by Spaceborne Precipitation Radar  

Science Conference Proceedings (OSTI)

In this study, the authors used Tropical Rainfall Measuring Mission precipitation radar (TRMM PR) data to investigate changes in the actual (attenuation corrected) surface backscattering cross section (?0e) due to changes in surface conditions ...

Shinta Seto; Toshio Iguchi



TRMM Calibration of SSM/I Algorithm for Overland Rainfall Estimation  

Science Conference Proceedings (OSTI)

This paper extends the work of Dinku and Anagnostou overland rain retrieval algorithm for use with Special Sensor Microwave Imager (SSM/I) observations. In Dinku and Anagnostou, Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) ...

Tufa Dinku; Emmanouil N. Anagnostou



Putting downward pressure on natural gas prices: The impact of renewable energy and energy efficiency  

E-Print Network (OSTI)

rgy Can Help Ease the Natural Gas Crunch. Cambridge, Mass. :Modeling Forum (EMF). 2003. Natural Gas, Fuel Diversity andM. de Leon. 2003. Natural Gas and Energy Pr ice Volatility.

Wiser, Ryan; Bolinger, Mark; St. Clair, Matthew



Studienjahr 2012/2013 Public Health I  

E-Print Network (OSTI)

sind in ILIAS hinterlegt. Hurrelmann K, Klotz T, Haisch J (Hrsg.) (2004). Lehrbuch Prävention und, Siegrist J, Walter U (Hrsg.) (2003). Das Public Health Buch ­ Gesundheit und Gesundheitswesen. 2. Auflage

Manstein, Dietmar J.


MHH Forschungsbericht 2004 539 Abteilung Rechtsmedizin  

E-Print Network (OSTI)

, Wunna Lippert-Burmester (Hrsg.): Anatomie in Frage und Antwort: mündliche Prüfung 278 Seiten Vierte (Hrsg.): Läsionen peripherer Nerven und radikuläre Syndrome 472 Seiten Achte, überarbeitete und

Manstein, Dietmar J.


27.09.2011 Public Health I  

E-Print Network (OSTI)

Lernmaterialien sind in ILIAS hinterlegt. Hurrelmann K, Klotz T, Haisch J (Hrsg.) (2004). Lehrbuch Prävention und, Siegrist J, Walter U (Hrsg.) (2003). Das Public Health Buch ­ Gesundheit und Gesundheitswesen. 2. Auflage

Manstein, Dietmar J.


Probabilistic Parameterizations of Visibility Using Observations of Rain Precipitation Rate, Relative Humidity, and Visibility  

Science Conference Proceedings (OSTI)

This study analyzes the occurrence of the visibility (Vis) versus precipitation rates (PR) for rain and versus relative humidity (RH) from surface observations that were collected during the Fog Remote Sensing and Modeling (FRAM) field project, ...

I. Gultepe; J. A. Milbrandt



Dietary Fats and Risk of Chronic DiseaseChapter 15 Perinatal Supplementation of Long-chain Polyunsaturated Fatty Acids as a Strategy to Prevent Adult Diseases  

Science Conference Proceedings (OSTI)

Dietary Fats and Risk of Chronic Disease Chapter 15 Perinatal Supplementation of Long-chain Polyunsaturated Fatty Acids as a Strategy to Prevent Adult Diseases Health Nutrition Biochemistry eChapters Health - Nutrition - Biochemistry Pr


Relating Convective and Stratiform Rain to Latent Heating  

Science Conference Proceedings (OSTI)

The relationship among surface rainfall, its intensity, and its associated stratiform amount is established by examining observed precipitation data from the Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR). The results show ...

Wei-Kuo Tao; Stephen Lang; Xiping Zeng; Shoichi Shige; Yukari Takayabu



Bayesian Retrieval of Complete Posterior PDFs of Oceanic Rain Rate from Microwave Observations  

Science Conference Proceedings (OSTI)

A new Bayesian algorithm for retrieving surface rain rate from Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI) over the ocean is presented, along with validations against estimates from the TRMM Precipitation Radar (PR). The ...

J. Christine Chiu; Grant W. Petty



A Cloud and Precipitation Feature Database from Nine Years of TRMM Observations  

Science Conference Proceedings (OSTI)

An event-based method of analyzing the measurements from multiple satellite sensors is presented by using observations of the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR), Microwave Imager (TMI), Visible and Infrared ...

Chuntao Liu; Edward J. Zipser; Daniel J. Cecil; Stephen W. Nesbitt; Steven Sherwood



United States Government Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

;-. h- - -- - - -- - (08-93) United States Government Department of Energy memorandum DATE: August 13, 2007 1 Audit Report Number: OAS-L-07-20 REPLY TO ATTN OF: IG-32 (A07PR058)...



NLE Websites -- All DOE Office Websites (Extended Search)

503 V. Kuznetsov, M.V. Polyakov, M. Thurmann (INRM+) REFID53753 MART 11 PR D83 094015 T. Mart (U. Indonesia) REFID51818 KUZNETSOV 07 PL B647 23 V. Kuznetsov et al. (GRAAL Collab....



NLE Websites -- All DOE Office Websites (Extended Search)

V. Kuznetsov, M.V. Polyakov, M. Thurmann (INRM+) MART 11 PR D83 094015 T. Mart (U. Indonesia) KUZNETSOV 07 PL B647 23 V. Kuznetsov et al. (GRAAL Collab.) HTTP:PDG.LBL.GOV Page...


NREL: Energy Analysis - Barry Friedman  

NLE Websites -- All DOE Office Websites (Extended Search)

Renewable Energy Laboratory). 28 pp.; NREL Report No. PR-6A20-55130. Friedman, B.; Jordan, P.; Carrese, J. (2011). Solar Installation Labor Market Analysis. 75 pp.; NREL Report...


careInlorlladon Infrastructure:  

Science Conference Proceedings (OSTI)

... BrInging HeaithcG1eOnline: Th~ Rot. of infotmotIon Technologiu, OTA-rrc-624, USGovernment PrInting Office. Washington. Dc.1995.) ...



The Tropical Dynamical Response to Latent Heating Estimates Derived from the TRMM Precipitation Radar  

Science Conference Proceedings (OSTI)

A 3-yr (19982000) climatology of near-surface rainfall and stratiform rain fraction observed by the Tropical Rainfall Measuring Mission (TRMM) precipitation radar (PR) was used to calculate the four-dimensional distribution of tropical latent ...

Courtney Schumacher; Robert A. Houze Jr.; Ian Kraucunas


Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

Pakistan Vêt. J., 22(4): 2002 STRESS MANAGEMENT FOLLOWING VACCINATION AGAINST COCCIDIOSISPathology, 'Department ofParasitology University ofVeterinary and Animal sciences, Lahore, Pakistan ABSTRACT The présent

Paris-Sud XI, Université de


Diurnal Variability of Tropical Rainfall Retrieved from Combined GOES and TRMM Satellite Information  

Science Conference Proceedings (OSTI)

Recent progress in satellite remote-sensing techniques for precipitation estimation, along with more accurate tropical rainfall measurements from the Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI) and precipitation radar (PR) ...

S. Sorooshian; X. Gao; K. Hsu; R. A. Maddox; Y. Hong; H. V. Gupta; B. Imam



AOCS Official Method Ba 9-58  

Science Conference Proceedings (OSTI)

Urease Activity AOCS Official Method Ba 9-58 Methods Methods and Analyses Analytical Chemistry Methods Downloads Methods Downloads DEFINITION This method determines the presence of residual urease in soybean pr


Vertical Structure of Hurricane Eyewalls as Seen by the TRMM Precipitation Radar  

Science Conference Proceedings (OSTI)

Statistical analysis of the vertical structure of radar echoes in the eyewalls of tropical cyclones, shown by the Tropical Rainfall Measurement Mission (TRMM) Precipitation Radar (PR), shows that the eyewall contains high reflectivities and high ...

Deanna A. Hence; Robert A. Houze Jr.



Vertical Structure of Tropical Cyclone Rainbands as Seen by the TRMM Precipitation Radar  

Science Conference Proceedings (OSTI)

Ten years of data from the Tropical Rainfall Measurement Mission satellites Precipitation Radar (TRMM PR) show the vertical structure of tropical cyclone rainbands. Radar-echo statistics show that rainbands have a two-layered structure, with ...

Deanna A. Hence; Robert A. Houze Jr.



Equivariant, locally finite inverse representations with uniformly bounded zipping length, for arbitrary finitely presented groups  

E-Print Network (OSTI)

This is the first of a three parts paper providing full details for our previous announcement in Pr\\'epublications Orsay 2007-16, arXiv:0711.3579. Here we prove the results stated in the title.

Poenaru, Valentin



A Physical Model for Wildland Fires J.H. Balbi*  

E-Print Network (OSTI)

1 A Physical Model for Wildland Fires J.H. Balbi* , J.B. Filippi, F. Morandini, F. Rinieri and X. Silvani Corresponding author: Pr. Jacques-Henri Balbi, balbi@univ-corse.fr. Laboratory for the Physical

Paris-Sud XI, Université de


Technical Program, Tuesday Morning Sessions - TMS  

Science Conference Proceedings (OSTI)

OMVPE Growth of GaInAsSb/AlGaAsSb for Quantum-Well Diode Lasers: C.A. ... Germany, * Institute of Physics, Belarus Academy of Science, F. Skaryna pr.


Michel Claessens michel.claessens@iter.org  

E-Print Network (OSTI)

on the manufacturing of critical components, were among the important issues discussed at the eighth meeting. Photos of the Council Meeting can be found at: http://www.iter.org/gallery/pr_2011_06_ic8 Additional


Oilseed Meal Laboratory Proficiency Testing Program  

Science Conference Proceedings (OSTI)

Lab Proficiency Testing provider for Oilseed Meals.Samples in this series include Soybean Meal, Canola Meal, Peanut Meal, cottonseed Meal, Safflower Meal, Protein Concentrate. Oilseed Meal Laboratory Proficiency Testing Program Laboratory Proficiency Pr



NLE Websites -- All DOE Office Websites (Extended Search)

Special Topics & Beam Vol. 14, pg. 022801, 2011. ANL-HEP-PR-10-64 Increasing the Transformer Ratio at the AWA C. Jing (Euclid Techlabs, LLC), W. Gai, J. G. Power, M. Conde, W....


ConvectiveStratiform Precipitation Variability at Seasonal Scale from 8 Yr of TRMM Observations: Implications for Multiple Modes of Diurnal Variability  

Science Conference Proceedings (OSTI)

This study investigates the variability of convective and stratiform rainfall from 8 yr (19982005) of Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR) and TRMM Microwave Imager (TMI) measurements, focusing on seasonal diurnal ...

Song Yang; Eric A. Smith



Guidance for Preparing ENERGY STAR Challenge for Industry Plant...  

NLE Websites -- All DOE Office Websites (Extended Search)

Award Recipient of the ENERGY STAR Challenge for Industry Suzhou Facility BD Medical No.5 Baiyu Road Suzhou Industrial Park Jiangsu P.R. China In 1995 BD became the second...


Microsoft Word - Final Report.doc  

NLE Websites -- All DOE Office Websites (Extended Search)

Final Report, Contract No. PR-239-9439, 1997. 6. Stone, Richard, Introduction to Internal Combustion Engines, Society of Automotive Engineers, 1999. 7. Wood, C.D., et al,...


Agreement Between Cornell University  

E-Print Network (OSTI)

/PR URL: http://www.dotomi.com Job Titles: Engineering/IT Apprentice, Client Development/Sales Apprentice, Media Apprentice, Account Management Apprentice, Quality Assurance Apprentice Majors: Business: Business. - BS, Engineering: Contract Major, Engineering: Electrical, Engineering: Industrial, Engineering

Wang, Z. Jane


Corporate Ownership and Initial Training in Britain, Germany and Switzerland  

E-Print Network (OSTI)

/PR URL: http://www.dotomi.com Job Titles: Engineering/IT Apprentice, Client Development/Sales Apprentice, Media Apprentice, Account Management Apprentice, Quality Assurance Apprentice Majors: Business: Business. - BS, Engineering: Contract Major, Engineering: Electrical, Engineering: Industrial, Engineering

Davies, Christopher


Artificial Intelligence and Systems Engineering  

E-Print Network (OSTI)

/PR URL: http://www.dotomi.com Job Titles: Engineering/IT Apprentice, Client Development/Sales Apprentice, Media Apprentice, Account Management Apprentice, Quality Assurance Apprentice Majors: Business: Business. - BS, Engineering: Contract Major, Engineering: Electrical, Engineering: Industrial, Engineering

Sommerville, Ian


Standards, and Student Testing (CRESST)  

E-Print Network (OSTI)

The work reported herein was supported under the Educational Research and Development Centers Program, PR/Award Number R305C080015. The findings and opinions expressed here do not necessarily reflect the positions or policies of the National

M Ay; Deirdre S. Kerr; Deirdre S. Kerr; Gregory K. W. K. Chung



Premier Congrs national des nergies renouvelables et de l`efficacit nergtique  

E-Print Network (OSTI)

Smartgrid. Le réseau intelligent Futur énergétique: à l'avenir, l'électricité Réseau de gaz: le présent et l

Richner, Heinz



Annual Energy Outlook 2012 (EIA)

lease condensate) a nd l iquid hy drocarbons pr oduced fr om tar sands, gilsonite and oil shale of both foreign and domestic origin t hat i s c harged t o th e atmospheric c rude...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Processing to Control Morphology and Texture in Magnetic Materials  

Science Conference Proceedings (OSTI)

... in Nanocrystalline Soft Magnetic Alloys Effect of Particle Size on the Coercivity of R-Fe-B (R=Nd, Pr) Powders Prepared by Surfactant-Assisted Ball Milling.


Frying Technology and PracticesChapter 4 Role of Antioxidants and Polymerization Inhibitors in Protecting Frying Oils  

Science Conference Proceedings (OSTI)

Frying Technology and Practices Chapter 4 Role of Antioxidants and Polymerization Inhibitors in Protecting Frying Oils Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr


The Threatened Atlantic Elkhorn Coral, Acropora palmata: Population Dynamics and Their Policy Implications.  

E-Print Network (OSTI)

Coral-reef geology: Puerto Rico and the US Virgin Islands.Diadema antillarum in Puerto Rico 20 years after a massJAM), Navassa (NAV), Puerto Rico (PR), and Virgin Gorda (

Vardi, Tali



Associations between the legal context of HIV, perceived social capital, and HIV antiretroviral adherence in North America  

E-Print Network (OSTI)

77082, USA. 14 University of Puerto Rico, PO Box 365067, SanJuan, PR 00936-5067, Puerto Rico. 15 Global Health andUnited States, including Puerto Rico. The study protocol was



Assessing Animal Vocal Communication Using the Hyperspace Analog to Language (HAL) Model  

E-Print Network (OSTI)

SONG: By song. PR = Puerto Rico, TC = Turks and Caicos, LA =middle geographic area (Puerto Rico), that is a combinationLastly, the songs in Puerto Rico appear to be slightly more

Kaufman, Allison B.



New Program Review and Analysis Office to Improve NNSA's Budgeting...  

National Nuclear Security Administration (NNSA)

in restructuring several major defense acquisition programs. He most recently led the OSD-CAPE review of the B61 Life Extension Program. "With the creation of PR&A, we...


Molecular research suggests shift needed in how drugs are created  

NLE Websites -- All DOE Office Websites (Extended Search)

Molecular research suggests shift needed in how drugs are created -Press: Release Number: PR-UIUC-05-2 -Source: University of Illinois at Urbana Champaign -Date issued: October 3,...


Application of lanthanide-induced shifts in solution NMR studies of coordinated extractants. [Dibutylbutylphosphonate; butyldibutylphosphinate  

SciTech Connect

A NMR study was conducted to study the coordination of monofunctional extractants (TBP, dibutylbutylphosphonate, and butyldibutylphosphinate) and bifunctional extractants (DHDECMP). Pr, Eu, and Yb ions were used as solution structural probes. (DLC)

Kalina, D.G.; Horwitz, E.P.



Comparative Toxicity of Gambierdiscus toxicus, Ostreopsis cf. ienticuiaris, and Associated Microflora  

E-Print Network (OSTI)

Microflora 1. R. TOSTESON, D. L. BALLANTINE, C. G. TOSTESON, A. 1. BARDALES, H.D. DURST, and 1. B. HIGERD, University of Puerto Rico, Mayaguez, PR 00708. H. D. Durst is with the Department of Chemistry, University


Diurnal LandSea Rainfall Peak Migration over Sumatera Island, Indonesian Maritime Continent, Observed by TRMM Satellite and Intensive Rawinsonde Soundings  

Science Conference Proceedings (OSTI)

The diurnal cycle of rainfall and its regional variation over Sumatera Island, Indonesian Maritime Continent, are examined using Tropical Rainfall Measuring Mission (TRMM) satellite precipitation radar (PR) and intensive rawinsonde sounding data. ...

Shuichi Mori; Hamada Jun-Ichi; Yudi Iman Tauhid; Manabu D. Yamanaka; Noriko Okamoto; Fumie Murata; Namiko Sakurai; Hiroyuki Hashiguchi; Tien Sribimawati




NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BARYONS BARYONS BARYONS ...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) c c MESONS c c MESONS c c MESONS c...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) STRANGE MESONS STRANGE MESONS...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) CHARMED BARYONS CHARMED BARYONS...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BARYONS BARYONS BARYONS ...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BARYONS BARYONS BARYONS...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BOTTOM, CHARMED MESONS BOTTOM,...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BOTTOM BARYONS BOTTOM BARYONS...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) BOTTOM, STRANGE MESONS BOTTOM,...



NLE Websites -- All DOE Office Websites (Extended Search)

Citation: J. Beringer et al. (Particle Data Group), PR D86, 010001 (2012) and 2013 partial update for the 2014 edition (URL: http:pdg.lbl.gov) bb MESONS bb MESONS bb MESONS bb...

Note: This page contains sample records for the topic "12a pr c86" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


--No Title--  

NLE Websites -- All DOE Office Websites (Extended Search)

3, 915-923 (2007). ANL-HEP-PR-07-57 High Transformer Ratios in Collinear Wakefield Accelerators J.G. Power, M. Conde, C. Jing, P. Schoessow and A. Kanareykin Presented at Particle...


Cuan importante es e-E Raul Toral  

E-Print Network (OSTI)

hidr´ogeno, es decir, ser´ia a todos los efectos pr´acticos una funci´on delta de Dirac3 : P(E) (E - U

Toral, Raúl


Interfacial Reconstruction and Superconductivity in YBa2Cu3O7-x ...  

Science Conference Proceedings (OSTI)

Presentation Title, Interfacial Reconstruction and Superconductivity in YBa2Cu3O7-x and Pr0.68Ca0.32MnO3 Superlattices. Author(s), Jonas Norpoth, Dong Su,...


Research on the Process of Alkaline Pressure Oxidation for ...  

Science Conference Proceedings (OSTI)

Characterization of Fluorescent Lamp Glass Waste Powders for ... Comparison between HDPE/Clay and HDPE/Piassava Fiber/Clay Treated by ... Effects of Rare Earth Pr on the Mechanical and Electrochemical Properties of Pb-based Alloys.


Reduced Building-Vat-Size-Design for Process Parameter ...  

Science Conference Proceedings (OSTI)

To minimize total powder usage of costly powders as well as processing time and ... Comparison between HDPE/Clay and HDPE/Piassava Fiber/Clay Treated by ... Pr on the Mechanical and Electrochemical Properties of Pb-based Alloys.


--No Title--  

NLE Websites -- All DOE Office Websites (Extended Search)

2nd U.S.-China NOx and SO2 Control Workshop Dalian Bangchui Island Hotel Dalian, Liaoning Province, P.R. China August 2 - 5 2005 Table of Contents Disclaimer Papers and...


TRMM Observations of Intraseasonal Variability in Convective Regimes over the Amazon  

Science Conference Proceedings (OSTI)

This study utilizes the Tropical Rainfall Measuring Mission (TRMM) satellite precipitation radar (PR), lightning imaging sensor (LIS), and passive microwave imager (TMI) data together with ground-based lightning data to investigate the vertical ...

Walter A. Petersen; Stephen W. Nesbitt; Richard J. Blakeslee; Robert Cifelli; Paul Hein; Stephen A. Rutledge



Appendix: Concepts of Linear Algebra In this appendix, some essential topics in linear algebra are reviewed. For each topic, we present  

E-Print Network (OSTI)

(SDS) P 0 . (ii) if µ(p) > max 4/c1, 2 2/ck (a constant) then lim p Pr(SDS = ) = 1 , if x = 0 0 , if x

Chen, Mei-Qin


Following recipes with a cooking robot  

E-Print Network (OSTI)

In this thesis, we present BakeBot, a PR2 robot system that interprets natural language baking recipes into baking instructions which it follows to execute the recipe, from mise en place presentation of the ingredients ...

Bollini, Mario Attilio



NETL F 451.1-1/1 Categorical Exclusion (CX) Designation Form  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NETLSOD FE DS080610, PR 11FE001431 OIBOSite Operations Division 2011 Gregg Sawl April 2011 - May 2011 NETL PGH: South Park Township, PA Building 141 Fixed Ladder Installation...



E-Print Network (OSTI)

- the ground multiplet with three substates in the cx- tion, however in the presence of an external field pulses are therefore able to connect every substate in moment would eliminate the F--Pr 3~magneticinterac


Microscopie deux photons Boudewijn van der Sanden, Ph.D  

E-Print Network (OSTI)

: 3 Prédiction effets Radiothérapie #12;New insights on cell death from radiation exposure · DNA (x,y) Z-translation Internal PMTs Filter cube red green External PMTs Bio-Rad interface Dichroic

Vial, Jean-Claude


Cholesterol and Phytosterol Oxidation ProductsChapter 2 Extraction and Purification of Cholesterol Oxidation Products  

Science Conference Proceedings (OSTI)

Cholesterol and Phytosterol Oxidation Products Chapter 2 Extraction and Purification of Cholesterol Oxidation Products Food Science Health Nutrition Biochemistry eChapters Food Science & Technology Health - Nutrition - Biochemistry Pr


Home range plus: A space-time characterization of movement over real landscapes  

E-Print Network (OSTI)

article as: Lyons et al. : Home range plus: a space-timeJM, Moorcroft PR: The home-range concept: Are traditionalMJ: A Critical Review of Home Range Studies. Journal of

Lyons, Andrew J; Turner, Wendy C; Getz, Wayne M



Spatiotemporal Variation of the Vertical Gradient of Rainfall Rate Observed by the TRMM Precipitation Radar  

Science Conference Proceedings (OSTI)

Seasonal and spatial variation of the vertical gradient of rainfall rate was investigated using global precipitation data observed by the Precipitation Radar (PR) on the Tropical Rainfall Measuring Mission (TRMM) satellite. The vertical gradient ...

Masafumi Hirose; Kenji Nakamura




E-Print Network (OSTI)

ON METHODOLOGY: FROM WIND POWER FREQUENCY TO LOSS-OF-LOADJ.P. , "Some Aspects of Wind Power Statistics, " J. of Appl.SCTION Reliability of Wind Power From Dispersed Sites: A Pr

Kahn, E.




E-Print Network (OSTI)

isolated by bulb to bulb distillation at torr Pr rat of 1,4-dried over Mgso 4 ; distillation through a Ta wire column atcru er as eluent (7:3 distillation ( 03 torr) ev e alcohol

Lockhart, Thomas P.



COURSE UNIT LIST 2011-12 Year Courses  

E-Print Network (OSTI)

Rumford Autumn ½ PR3491 Democracy & Authoritarianism: India and Pakistan Dr Datta/Dr Khan Autumn/Spring 1 and the operation of nuclear deterrence in Europe prior to 1989. The course will then begin to explore some

Sheldon, Nathan D.


Thesis - Lirmm  

E-Print Network (OSTI)

en prot?ine) seront pr?sents dans les g?nes copies ? condition qu'ils ..... nissent des r?gles combinatoires permettant de transformer un arbre DLS en un nouvel.


ATP Applications, Awards, & Participants by State  

Science Conference Proceedings (OSTI)

... Puerto Rico (PR), 1, 0, 0. Rhode Island (RI), 32, 6, 7. South Carolina (SC), 46, 6, 7. South Dakota (SD), 3, 0, 0. Tennessee (TN), 58, 2, 8. Texas (TX), 381 ...
