
- References and Notes 1. L. Van Parijs, A. K. Abbas, Science 280, 243 (1998).
- Molecular Cell, Vol. 8, 12911301, December, 2001, Copyright 2001 by Cell Press Structure of the SH3-Guanylate Kinase Module
- 11. Nijhawan, D. et al. Elimination of Mcl-1 is required for the initiation of apoptosis following ultraviolet irradiation. Genes Dev. 17, 14751486 (2003).
- Cell, Vol. 111, 565576, November 15, 2002, Copyright 2002 by Cell Press Structure of the N-WASP EVH1 Domain-WIP
- Molecular Cell, Vol. 17, 181191, January 21, 2005, Copyright 2005 by Elsevier Inc. DOI 10.1016/j.molcel.2004.11.054 A Polybasic Motif Allows N-WASP to
- DOI: 10.1126/science.1198701 , 680 (2011);332Science
- news and views 570 nature structural biology volume 8 number 7 july 2001
- www.sciencemag.org SCIENCE VOL 311 10 FEBRUARY 2006 789 CREDIT:P.HUEY/SCIENCE
- Park, et al. Supporting Online Materials for Park et al.
- Energetic Determinants of Internal Motif Recognition by PDZ Domains Baruch Z. Harris, Brian J. Hillier, and Wendell A. Lim*
- Clues to the evolution of complex signaling machinery Bruce J. Mayer*
- A new type of PDZ domain recognition Hartmut Oschkinat
- The Ste5 Scaffold Directs Mating Signaling by Catalytically Unlocking
- 994 Cell 136, March 20, 2009 2009 Elsevier Inc. In the work of Ezhkova et al., the con-
- Synaptotagmin I is necessary for compensatory synaptic
- PSD-95 Assembles a Ternary Complex with the N-Methyl-D-aspartic Acid Receptor and a Bivalent Neuronal NO Synthase PDZ Domain*
- Lipopenia and Skin Barrier Abnormalities in DGAT2-deficient Mice* Received for publication, October 6, 2003, and in revised form, December 10, 2003
- SUPPLEMENTARY INFORMATION 1www.nature.com/nature
- Signal transduction proteins that can integrate multiple upstream signals play a critical role in the complex regulatory
- Supplemental Data The Role of Docking Interactions in Mediating
- Neuron, Vol. 38, 417432, May 8, 2003, Copyright 2003 by Cell Press ATP-Sensitive Potassium Channel Traffic Regulation
- Cell, Volume 138 Supplemental Data
- Defining Network Topologies that Can Achieve Biochemical Adaptation
- CHEMISTRY & CHEMICAL BIOLOGY GRADUATE PROGRAM Application Instructions and Checklist
- Many eukaryotic signal transduction proteins have component-based architectures: they are built from combinations of
- Enhancing ties between academia and industry to improve health
- A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains
- Engineering Modular Protein Interaction Switches by Sequence Overlap
- DOI: 10.1126/science.1182376 , 368 (2010);328Science
- Developmental Cell Developmental Cell, Vol. 8, February, 2005, Copyright 2005 by Elsevier Inc. DOI 10.1016/j.devcel.2005.01.002
- Administration, Access and DeliveryAdministration, Access and Delivery Jim MunsonJim Munson
- Role of Electrostatic Interactions in PDZ Domain Ligand Recognition Baruch Z. Harris,, Francis W. Lau, Naoaki Fujii,| R. Kiplin Guy,| and Wendell A. Lim*,
- BIOSIS Previews on the Web (OVID) BIOSIS Previews is the world's most comprehensive reference database for life science research. It covers
- TheJournalofCellBiology The Rockefeller University Press, 0021-9525/2003/09/1003/14 $8.00
- The Pathogen Protein EspFU Hijacks Actin Polymerization Using Mimicry and Multivalency
- Engineering synthetic signaling proteins with ultrasensitive input/
- www.stke.org/cgi/content/full/sigtrans;2003/179/re8 Page 1 One particularly abundant group of modular recogni-
- 180 190 200 210 220 230 240 250 260 270 NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAP
- SSutter Street Bush Street
- 526 VOLUME 26 NUMBER 5 MAY 2008 NATURE BIOTECHNOLOGY dengue viruses.These candidate vaccines seem
- C H A P T E R S E V E N T E E N Light Control of Plasma
- Supporting Information Pincus et al. 10.1073/pnas.0803161105
- sion features have also been reported for the disks around the stars MWC480 (9) and
- Domains, Motifs, and Scaffolds: The Role of
- FacultyandStaffAssistanceProgram 3333CaliforniaStreet,Suite293
- pubs.acs.org/Biochemistry Published on Web 10/14/2009 r 2009 American Chemical Society 10956 Biochemistry 2009, 48, 1095610962
- Bait and Switch: Synthetic GEFs Divert an Input Signal to Diverse Cellular Responses
- duced evidence to suggest that, in birds, dis-tinct allelic forms of Lps influence survival
- Evolution of the phospho-tyrosine signaling machinery in premetazoan lineages
- LIBRARY & CKM -COPY SERVICES RECHARGE AUTHORIZATION
- Supplemental Figure legends Yadav et al., "Reengineering the signaling properties of a Src family kinase"
- ListServ: List Owner's Guide Wednesday, 24 December 2008 22:26 -Last Updated Friday, 27 February 2009 23:51
- Computer Security & Policy Handbook Wednesday, 27 May 2009 16:57 -Last Updated Wednesday, 27 May 2009 18:17
- Spatiotemporal control of cell signalling using a light-switchable protein interaction
- Introduction An emerging paradigm in eukaryotic signal transduction is that
- Evolution of phosphoregulation Supplementary Information
- NEWS AND VIEWS Pimp my cell
- Synthetic biology: lessons from the history of synthetic organic chemistry
- Rewiring Cellular Morphology Pathways With Synthetic Guanine Nucleotide Exchange Factors
- 2011-2012 First Year Core Curriculum UCSF Integrative Program in Quantitative Biology (iPQB)
- 2010-2011 UCSF volunteers participating in programs of the Science & Health Education Partnership (SEP)
- Cell, Vol. 115, 389399, November 14, 2003, Copyright 2003 by Cell Press Evolution of a Combinatorial
- Leading Edge Cell 138, August 21, 2009 2009 Elsevier Inc. 619
- Making Translation Work BIOTECHNOLOGY'S LARGEST GLOBAL EVENT, THE BIO INTERNATIONAL CONVENTION, CONVENES
- www.sciencemag.org/cgi/content/full/328/5976/368/DC1 Supporting Online Material for
- 2011-12 UCSF Graduate Division Fellowships Prepared by Wendy Winkler 8/12/2011 Page 1
- background (3). The visual scoring scheme has been confirmed by histology as described [S. Parangi et al.,
- Tuesday, 14 July 2009 18:59 -Last Updated Tuesday, 14 July 2009 19:25 Virtual Private Networking (VPN) allows users to access University-restricted resources from
- Rewiring Cells: Synthetic Biology as a Tool to
- DispatchMAPK Signaling: Sho Business Bruce T. Seet1,2 and Tony Pawson1,2
- Molecular Cell, Vol. 14, 825832, June 18, 2004, Copyright 2004 by Cell Press Short ArticleSho1 and Pbs2 Act as Coscaffolds
- WHY WE LOVE OUR PROGRAM YEAR IPQB STUDENTS AT UCSF
- nature methods | VOL.8 NO.1 | JANUARY 2011 | 35 method of the year COMMENTARY | special feature
- news and views Specific proteinprotein interactions are
- Structure, Vol. 10, 39, January, 2002, 2002 Elsevier Science Ltd. All rights reserved. PII S0969-2126(01)00705-5 that lacks catalytic activity (Figure, panel A). SeveralMAGUK SH3 Domains--Swapped
- Mission Bay UCSF Campus Boundary
- Evolution of Phosphoregulation: Comparison of Phosphorylation Patterns across Yeast Species
- Molecular Cell, Vol. 20, 951962, December 22, 2005, Copyright 2005 by Elsevier Inc. DOI 10.1016/j.molcel.2005.10.030 The Role of Docking Interactions in Mediating
- Rewiring cellular morphology pathways with synthetic guanine nucleotide exchange factors
- Acknowledgements We thank M. Rees for comments on statistical analyses. This work was supported by the UK Natural Environment Research Council (NERC).
- In signalling networks, protein domains usually have a catalytic
- Choosing a Good Password Monday, 01 June 2009 21:36 -Last Updated Tuesday, 02 June 2009 13:36
- 13. G. Missale et al., J. Clin. Invest. 98, 706 (1996). 14. H. M. Diepolder et al., Lancet 346, 1006 (1995).
- Cell, Volume 136 Supplemental Data
- and right-sided circadian oscillators. This is a unique neural state, a "split" brain without sur-
- DOI: 10.1126/science.1151153 , 1539 (2008);319Science
- DGCR8 is essential for microRNA biogenesis and silencing of embryonic stem cell self-renewal
- Living cells are dynamic systems that use complex molec-ular signalling circuits to monitor external and internal
- ure have been structurally characterized (10).
- Supporting Information Engineering Modular Protein Interaction Switches by Sequence Overlap
- mail@UCSF: Welcome to Exchange Wednesday, 08 October 2008 19:05 -Last Updated Thursday, 17 September 2009 15:58
- In signalling networks, protein domains usually have a catalytic func
- no switch: spontaneous actin polymerization (MINIMAL ACTIVTY) FractionActin
- Docking interactions in protein kinase and phosphatase Attila Reme nyi, Matthew C Good and Wendell A Lim
- www.sciencemag.org/cgi/content/full/319/5869/1539/DC1 Supporting Online Material for
- Science Supporting Online Material Dueber et al., p. 1 10.1126/science.1085945
- Coordinated Folding and Association of the LIN-2, -7 (L27) Domain AN OBLIGATE HETERODIMERIZATION MODULE INVOLVED IN ASSEMBLY OF SIGNALING AND CELL
- Rewiring cell signaling: the logic and plasticity of eukaryotic protein circuitry
- Improving SH3 domain ligand selectivity using a non-natural Jack T Nguyen1, Margaret Porter2, Mehran Amoui2, W Todd Miller2,
- Cell, Vol. 97, 471480, May 14, 1999, Copyright 1999 by Cell Press Structure of the Enabled/VASP Homology 1
- Reprogramming Control of an Allosteric Signaling Switch
- The pathogen protein EspFU hijacks actin polymerization using mimicry and multivalency
- 2011NatureAmerica,Inc.Allrightsreserved. BRIEF COMMUNICATIONS
- Nature Methods Light-based feedback for controlling intracellular signaling
- Recruitment interactions can override catalytic interactions in determining the functional
- Role of Mammalian Vacuolar Protein-sorting Proteins in Endocytic Trafficking of a Non-ubiquitinated G Protein-coupled Receptor
- Pseudomonas aeruginosa fimL is involved in regulating type IV pili function and1 cytotoxicity.2
- Leading Edge Phosphotyrosine Signaling: Evolving a New
- Bypassing a Kinase Activity with an ATP-Competitive Drug
- 2003 NaturePublishing Group L E T T E R S
- The Minimal Autoinhibited Unit of the Guanine Nucleotide Exchange Factor Intersectin
- Supporting Information Won et al. 10.1073/pnas.1016337108
- Molecular Cell, Vol. 13, 201212, January 30, 2004, Copyright 2004 by Cell Press The Glc7p Nuclear Phosphatase
- A Mechanism-Based Cross-Linker for the Identification of Kinase-Substrate Dustin J. Maly, Jasmina A. Allen, and Kevan M. Shokat*
- The gene for paroxysmal non-kinesigenic dyskinesia encodes an enzyme in a stress
- / www.sciencexpress.org / 20 March 2003 / Page 1/ 10.1126/science.1084274 The Polycomb group (PcG) protein Eed is implicated in
- J. Biol. Chem. 273, 2372223728 (1998). 7. Graeler, M. & Goetzl, E. J. Activation-regulated expression and chemotactic function of sphingosine
- 25. Groh, V. et al. Cell stress-regulated human major histocompatibility complex class I gene expressed in gastrointestinal epithelium. Proc. Natl Acad. Sci. USA 93, 1244512450 (1996).
- Bypassing a Kinase Activity with an ATP-Competitive Drug
- Mechanism of Actin Network Attachment to Moving Membranes: Barbed End
- NATURE BIOTECHNOLOGY VOL 17 FEBRUARY 1999 http://biotech.nature.com 165 Control of intracellular signaling pathways in vivo would allow
- Introduction Feathers are a defining feature of birds. They are essential for