| Sample search results for: a-3 proteins weakly |
| 1 | Effect of pH and Ca2+-Induced Associations of Soybean YONG J. YUAN,*, ORLIN D. VELEV,, KEN CHEN, BRUCE E. CAMPBELL, | ||
|
Summary: B1b(G1), A2B1a(G2), A1bB2(G3), A5A4B3(G4), and A3B4(G5). Each subunit is composed of an acidic... formed protein-Na+ complex. The data obtained on the precipitation of soy proteins with weakly binding Ca... Effect of pH and Ca2+-Induced Associations of Soybean Proteins ... |
|||
|
Source: Velev, Orlin D. - Department of Chemical and Biomolecular Engineering, North Carolina State University |
|||
|
Collection: Materials Science ; Chemistry |
|||
| 2 | BIOLOGICAL FRAMEWORKS FOR ENGINEERS Session #5a [nm: Protein Form] | ||
|
Summary: . Session Outline: I. Protein Definition II. Protein Form and Function III. The weak can be strong... ME498/599 BIOLOGICAL FRAMEWORKS FOR ENGINEERS Session #5a [nm: Protein Form] General Objectives... : Discuss general functions of proteins and diversity in subunits within the biopolymer ... |
|||
|
Source: Sniadecki, Nathan J. - Department of Mechanical Engineering, University of Washington at Seattle |
|||
|
Collection: Biology and Medicine ; Engineering |
|||
| 3 | The PDB is a Covering Set of Small Protein Structures Daisuke Kihara and Jeffrey Skolnick* | ||
|
Summary: from ambiguous ab initio protein structure predictions. J. Comp. Chem. 22, 339353. A3. Reva, B. A... weakly hit threading template pro- teins together with protein-specific short-range22 and long-range23... . & Ortiz, A. (2000). Derivation of protein-specific ... |
|||
|
Source: Kihara, Daisuke - Department of Biological Sciences, Purdue University; Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Biology and Medicine ; Biotechnology ; Chemistry |
|||
| 4 | Biochimie . Author manuscript Analysis of protein contacts into Protein Units | ||
|
Summary: Biochimie . Author manuscript Page /1 18 Analysis of protein contacts into Protein Units Guilhem... Yvette cedex, FRANCE Abstract Three-dimensional structures of proteins are the support... focuses to understand the mechanisms of protein folding and stability. Furthermore, protein ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 5 | Biochimie (2009) in press Analysis of protein contacts into Protein Units | ||
|
Summary: of peeling are shown: (a) 3 PUs for R equal 20, (b) 9 PUs for R equal 90. Proteins are shown using Rasmol... if that is sometimes weak. Analysis of the inter-PU contacts is more complex because proteins associated with a SCOP... 1 Biochimie (2009) in press Analysis of ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 6 | CH O Hydrogen Bonds at Protein-Protein Interfaces*S Received for publication, May 8, 2002, and in revised form, July 8, 2002 | ||
|
Summary: the existence of a weak C H O hydrogen bond between the parallel -sheets in proteins (17, 59, 60). At the same... time, some mutation studies on protein-ligand inter- actions have reported that weak CH O bonds... H donor d0 a d b d c Å Å Å Adjacent -strands in parallel orientation 2kin O Arg297B C ... |
|||
|
Source: Luhua, Lai - Institute of Physical Chemistry, Peking University |
|||
|
Collection: Chemistry ; Biotechnology |
|||
| 7 | Potential of Mean Force for ProteinProtein Interaction Studies | ||
|
Summary: 1a2x 1a2y 1a3r 1a4y 1a94 1acb 1ak4 1apm 1aqd 1ava 1avg 1avw 1axi 1ay7 1aya 1azs 1azz 1b0n 1b2s 1b33... Potential of Mean Force for ProteinProtein Interaction Studies Lin Jiang,1,2 Ying Gao,1,2 Fenglou... Studies of Stable and Unstable Species, Beijing, China ABSTRACT Calculating proteinprotein inter- ... |
|||
|
Source: Luhua, Lai - Institute of Physical Chemistry, Peking University |
|||
|
Collection: Chemistry ; Biotechnology |
|||
| 8 | Local Motions in a Benchmark of Allosteric Proteins Michael D. Daily1 | ||
|
Summary: to- ward weakly constrained regions such as loops and the protein surface. Correlation functions show... weakly constrained regions and local correlation of motion. However, allosteric proteins exhibit twice... separation, re- spectively. Nonallosteric proteins with ligand-induced motion ... |
|||
|
Source: Gray, Jeffrey J. - Department of Biomolecular and Chemical Engineering, Johns Hopkins University |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 9 | BioMed Central Page 1 of 16 | ||
|
Summary: I (topA 3) NAH - 18 20 19 JHP0693 hypothetical protein HP0756 24 59 1490 20 JHP0632 N... outer membrane protein (omp26) JHP1084 HP1157 24 24 18 topoisomerase I (topA 3) JHP0931 NAH 18 20 19... topoisomerase I (topA 3) JHP0931 ... |
|||
|
Source: Jarvis, Stephen - Department of Computer Science, University of Warwick |
|||
|
Collection: Mathematics |
|||
| 10 | The fX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells | ||
|
Summary: , and a3, have solved this problem by coding for a highly positively charged nucleic acid-binding protein... the a3 and G4 J proteins by virtue of an additional nucleic acid- binding domain at the amino terminus... instability during DNA packaging. However, chimeric ... |
|||
|
Source: Rossmann, Michael G. - Department of Biological Sciences, Purdue University |
|||
|
Collection: Biology and Medicine |
|||
| 11 | A Two-Step Approach for Clustering Proteins based on Protein Interaction Pengjun Pei and Aidong Zhang | ||
|
Summary: of the product of two conditional probabilities: PMBA = CN(B)N(k-1)(A) P(B|C) P(C|A), (3) #12;A EC D B F G I H... are very weak in affecting a protein's an- notation. This justifies our calculation of positive messages... A Two-Step Approach for Clustering Proteins based on ... |
|||
|
Source: Buffalo, State University of New York - Department of Computer Science and Engineering, Bioinformatics, Database, Data Mining, and Multimedia Group |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 12 | MICROBIOLOGICAL REVIEWS, Mar. 1995, p. 94123 Vol. 59, No. 1 0146-0749/95/$04.00 0 | ||
|
Summary: those that are weakly retained. VOL. 59, 1995 PROTEIN-PROTEIN INTERACTIONS 97 #12;the cyanogen bromide... , for the detection of weak protein-protein interactions, the concen- tration of bound protein should be as high... , American Society for Microbiology ... |
|||
|
Source: Economou, Tassos - Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Hellas |
|||
|
Collection: Biology and Medicine |
|||
| 13 | INSTITUTE OF PHYSICS PUBLISHING PHYSICAL BIOLOGY Phys. Biol. 2 (2005) S36S43 doi:10.1088/1478-3975/2/2/S04 | ||
|
Summary: average 69.2 °A 3 versus 38.1 °A 3 ), and a strong correlation (r2 = 0.94) between the hot spot... .1088/1478-3975/2/2/S04 Character and evolution of proteinprotein interfaces Ivica Res and Olivier Lichtarge Department... at stacks.iop.org/PhysBio/2/S36 Abstract ... |
|||
|
Source: Lichtarge, Olivier - Department of Molecular and Human Genetics, Baylor College of Medicine |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 14 | Classifying RNA-Binding Proteins Based on Electrostatic Shula Shazman, Yael Mandel-Gutfreund* | ||
|
Summary: Classifying RNA-Binding Proteins Based on Electrostatic Properties Shula Shazman, Yael Mandel... -Gutfreund* Faculty of Biology, Technion--Israel Institute of Technology, Haifa, Israel Abstract Protein structure can... provide new insight into the biological function of a protein and can enable the design of better |
|||
|
Source: Mandel-Gutfreund, Yael - Department of Biology, Technion, Israel Institute of Technology |
|||
|
Collection: Biology and Medicine |
|||
| 15 | Protein-DNA Interactions: Reaching and Recognizing the Targets A. G. Cherstvy,*,,| A. B. Kolomeisky,*, and A. A. Kornyshev*, | ||
|
Summary: is large because of weak attraction or even repulsion between the protein and DNA, which prevents scanning... is the exact result eq A3, thick dotted curve is the expansion eq 26. Parameters: h ) 3.4 Å, ) 1/(7 Å... of simplification from the initial expression for the recognition energy (eq ... |
|||
|
Source: Kolomeisky, Anatoly B.- Department of Chemistry, Rice University |
|||
|
Collection: Chemistry |
|||
| 16 | Supporting Information (SI) Appendix Part 1. Impact of tissue preparation, LMD, and RNA amplification on array output. p. 2 | ||
|
Summary: ATMG01220 unknown protein --- --- --- x ATMG00060 unknown protein --- x --- x AT4G27652 unknown protein... -2 --- --- --- --- AT2G07701 unknown protein --- x --- x AT2G07712 pseudogene, similar to maturase-related protein --- x... --- --- AT1G16040 unknown protein --- ... |
|||
|
Source: Wildermuth, Mary C - Department of Plant and Microbial Biology, University of California at Berkeley |
|||
|
Collection: Biology and Medicine |
|||
| 17 | Geometric structures of proteins for understanding folding, discriminating natives | ||
|
Summary: area A = 4r2 is: V A3/2 . The volume of proteins, however, is found to scale linearly with the surface... of acetylcholinesterase (1ea5 ). It contains 32 resides and has a molecular volume of 986.3°A 3 . Two residues from... structure (2clj, castP id = 96), with 34 residues and a ... |
|||
|
Source: Liang, Jie - Department of Bioengineering, University of Illinois at Chicago |
|||
|
Collection: Engineering ; Biotechnology |
|||
| 18 | An Effective Solvent Theory Connecting the Underlying Mechanisms of Osmolytes and Denaturants for Protein Stability | ||
|
Summary: of water). This is approximately one-half the number of water molecules in a 55 M solution for a (40 A° )3... for weak denaturant solution where the protein is weakly attractive to the protein, such as 3*ps ¼ À0... , and increases the cooperativ- ity of the folding ... |
|||
|
Source: Plotkin, Steven S. - Department of Physics and Astronomy, University of British Columbia |
|||
|
Collection: Biology and Medicine ; Physics |
|||
| 19 | Published in: Proteomics 5, 212-221 (2005) Cell wall proteins in apoplastic fluids of Arabidopsis thaliana | ||
|
Summary: modifying protein Abstract Weakly bound cell wall proteins of Arabidopsis thaliana were identified using... M CDTA in 0.3 M mannitol to remove weakly bound-cell wall proteins from the apoplast, as compared... 15 A1 A1 A2 A A A AA AA AA A1A1 A1 A1 A15 A17 A1 A19 A2 A2 A2A2 A2 A2A2 A2 A2 ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 20 | Vol. 23 no. 17 2007, pages 23142321 BIOINFORMATICS ORIGINAL PAPER doi:10.1093/bioinformatics/btm342 | ||
|
Summary: MIPS (Mewes et al., 2002) for yeast is used in our dataset (see Supplementary Material Table A3). 2... /btm342 Systems biology A statistical approach using network structure in the prediction of protein... : The Majority Vote approach has demonstrated that proteinprotein interactions can be used to predict |
|||
|
Source: Reinert, Gesine - Department of Statistics, University of Oxford |
|||
|
Collection: Mathematics |
|||
| 21 | Recombinant membrane protein production: past, present and | ||
|
Summary: Streptomyces coelicolor A3(2) OpuAA +OpuABC Glycine betaine transport 6119663 6119662 9 Lactococcus lactis... 7 Chapter 1 Recombinant membrane protein production: past, present and future Ravi K. R. Marreddy... , Eric R. Geertsma and Bert Poolman Abstract One of the major challenges in membrane protein ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 22 | RecA Protein Piero R Bianco, University of California, Davis, California, USA | ||
|
Summary: Only induced levels of RecA protein Stoichiometry in the first site 3:1 (nt: RecA) 3:1 (nt: RecA) 3... , including recA. Genes with operators that bind LexA protein weakly are the first to be expressed fully (e... RecA Protein ... |
|||
|
Source: Kowalczykowski, Stephen C. - Section of Microbiology, University of California, Davis |
|||
|
Collection: Biology and Medicine |
|||
| 23 | Introduction The anatomy and physiology of an organism is determined | ||
|
Summary: one in this group. **Borderline match: the evidence for homology between the proteins is very weak... ss Zig-2 e-54, 40% Zig-4 C09C7.1 253 ss Zig-3 e-72, 44% Zig-5 Y48A3A.1 260 Zig-6 T03G11.8 194 Zig-7 F... 05O09.1 2735 W06H8.3 588 M02D8.1 197 Y50E8A.3 151 Y38F1A.9 ... |
|||
|
Source: Teichmann, Sarah - Laboratory of Molecular Biology, MRC |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 24 | Application of Sparse NMR Restraints to Large-Scale Protein Structure Prediction | ||
|
Summary: %) proteins were folded to ,6.0 A° , 5.0 A° , 4.0 A° , 3.0 A° , and 2.0 A° , respectively. The average Ca... %) proteins were folded to a RMSD from native ,6.0 A° , 5.0 A° , 4.0 A° , 3.0 A° , and 2.0 A° respectively... , 36, 25, 12, and 1 ... |
|||
|
Source: Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 25 | Binding of small molecules to cavity forming mutants of a de novo designed | ||
|
Summary: , which bound benzene (96 A° 3 ). This binding also led to increased protein stability. The sizes... , I92, A93, and L96. The predicted volume of this cavity is 133 A° 3 . Das et al. PROTEIN SCIENCE VOL... and its mutants Benzene þ Protein KD ... |
|||
|
Source: Hecht, Michael H. - Departments of Chemistry & Molecular Biology, Princeton University |
|||
|
Collection: Chemistry ; Biotechnology |
|||
| 26 | A robust method to detect structural and functional remote homologues | ||
|
Summary: -binding domains (1opc, 1aoy, 1dprB, 1hst, 1ecl, 1bgw, 1smtA, 1lea, 1fokA) 3. 1lea / / / / / 3 226170 (348) TP = 1... A, 1lylA, 1cuk, 3ullA, 1cmkA, 1pfsA) 3. 1asy / / / / / 2 210265 (143) Detected: 1lyl 1. tox3_borpe 1 1... -type ATP Ppases (1nsyA, 1gpmA) 3. cysd_ecoli ... |
|||
|
Source: Linial, Michal - Sudarsky Center for Computational Biology & Department of Biological Chemistry, Hebrew University of Jerusalem |
|||
|
Collection: Biology and Medicine |
|||
| 27 | Influence of Protein Structure Databases on the Predictive Power of Statistical Pair Potentials | ||
|
Summary: lh7, 2lhb, 2sas, a2scp, p2tmv, a2utg, r2wrp, a3sdp, 451c, 4cpv, 4icb, a4sdh B -proteins 1acx, a1bbp... ltn, 2por, 2sas, a2scp, a2tbv, p2tmv, a2tsc, 3adk, 3cd4, 3cla, 3cna, 3dfr, 3lzm, 3pgm, a3sdp, a4dfr, 4... , and on the Test Proteins Considered /Test ... |
|||
|
Source: California at Davis, University of - Computer Science Department, Computer Science Theory Laboratory |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 28 | For polyhistidine-tagged protein purification BD Biosciences Clontech www.clontech.com 800-662-2566 | ||
|
Summary: in 50 mM sodium phosphate, 0.3 M NaCl, pH 7.0. Panel A. 3.2 ml culture filtrate was loaded at 0.5 ml... For polyhistidine-tagged protein purification BD Biosciences Clontech · www.clontech.com · 800... -scale purification of His-tagged proteins. Purify > 5 mg protein using 1 ml of ... |
|||
|
Source: Lebendiker, Mario - Wolfson Centre for Applied Structural Biology, Hebrew University of Jerusalem |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 29 | EFFICIENT DISCOVERY OF BINDING MOTIF PAIRS FROM PROTEINPROTEIN | ||
|
Summary: EFFICIENT DISCOVERY OF BINDING MOTIF PAIRS FROM PROTEINPROTEIN INTERACTIONS HAIQUAN LI (M... DNAs to Proteins . . . . . . . . . . . . . . . . . . . . . . . . 3 1.1.2 Protein Interactions... . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 1.1.3 Protein Interaction Sites . . . . . . . . . . . . . . . ... |
|||
|
Source: Wong, Limsoon - Department of Computational Science, National University of Singapore |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 30 | Comparative proteomic and transcriptomic profiling of the fission yeast Schizosaccharomyces pombe | ||
|
Summary: yeast Keywords: Fission yeast / protein profiling / LC-MS/MS / relative protein quantification / mRNA-protein... -free quantification of 1465 proteins. The fission yeast protein data showed considerable correlations with mRNA levels... and with the abundance of orthologous ... |
|||
|
Source: Wolf, Dieter A.- Burnham Institute for Medical Research |
|||
|
Collection: Biology and Medicine |
|||
| 31 | Published in association with the International Society for Computational Biology PUBLIC LIBRARY of SCIENCE | ploscompbiol.org | Volume 2 | Issue 7 | JULY 2006 | ||
|
Summary: Design of the Protein Universe #12;reference protein. In Figure 3A3C, we present the sequence identity... of SCIENCE | ploscompbiol.org | Volume 2 | Issue 7 | JULY 2006 #12;Emergence of Protein Fold Families through... of North Carolina at Chapel Hill, Chapel Hill, North Carolina, ... |
|||
|
Source: Dokholyan, Nikolay V. - Department of Biochemistry and Biophysics, University of North Carolina at Chapel Hill |
|||
|
Collection: Physics ; Biology and Medicine |
|||
| 32 | Published in: Phytochemistry 66, 453-461 (2005) Proteomic analysis of secreted proteins from Arabidopsis | ||
|
Summary: endotransferase) (EXGT- A3) (At-XTH27) A37-B37, C12-D12 At2g01850 1-20 (0.819) 36.2 6.5 13.5- 14.0 7-4.7 16 (41... 28 (exopolygalacturonase) A3-B3 At1g02790 1-31 (0.810) 41.3 9.5 42.3 4.6 16 Glycoside hydrolase... .3 8.6 9 (11) Peroxidase ATPEa A3-B3, D22 At2g38380 ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 33 | Pattern of Amino Acid Substitutions in Transmembrane Domains of b-Barrel Membrane Proteins for Detecting | ||
|
Summary: residues (L-M:16, L-A:10, I-A:3), and the aromatic residue F (L-F:32, I-F:5). Small polar residues... ), I (F-I:5), W (F-W:3) and A (F-A:3). The most abundant residue in the transmembrane segments of b... Pattern of Amino Acid Substitutions in Transmembrane Domains of b-Barrel Membrane ... |
|||
|
Source: Liang, Jie - Department of Bioengineering, University of Illinois at Chicago |
|||
|
Collection: Engineering ; Biotechnology |
|||
| 34 | Comparative proteomic and transcriptomic profiling of the fission yeast Schizosaccharomyces pombe | ||
|
Summary: R.FS#RILT#PGVAFLAPIIDK.I 3.3233 0.111 2118.3 474.6 0.441 SPAC18B11.11 GTPase activating protein K.VLS#EWLT#DLFTIIDDM*R.A... R.AS#LGEVPILAS#EEQLLK.D 2.6189 0.2339 1956.93 265.6 0.406 SPBC29A3.09c AAA family ATPase voltage... organization vma4 SPBC14F5.06 sec18 ... |
|||
|
Source: Wolf, Dieter A.- Burnham Institute for Medical Research |
|||
|
Collection: Biology and Medicine |
|||
| 35 | A Robust Method to Detect Structural and Functional Remote Homologues | ||
|
Summary: A, 1cuk, 3ullA, 1cmkA, 1pfsA) 3. 1asy / / / / / 2 210265 (143) Detected: 1lyl 1. Pertusis toxin 1. tox3... illustration (color-coded) of the weak connections between all 253 proteins in this cluster is provided at www... of protein sequences. It is still a much more challenging task to ... |
|||
|
Source: Linial, Michal - Sudarsky Center for Computational Biology & Department of Biological Chemistry, Hebrew University of Jerusalem |
|||
|
Collection: Biology and Medicine |
|||
| 36 | Computationalanalysisofmembraneproteins: genomicoccurrence,structurepredictionand | ||
|
Summary: Membrane protein PDB Vol. buried (A° 3 ) Ref. vol. buried RPE (%) Bacteriorhodopsin 2brd 7889 8030 98Á3... in the study of membrane proteins, focusing on those that have at least one transmembrane helix. Transmembrane... protein regions are, in many respects, easier to investigate ... |
|||
|
Source: Engelman, Donald M.- Department of Molecular Biophysics and Biochemistry, Yale University; Senes, Alessandro - Department of Biochemistry, University of Wisconsin at Madison; Xia, Yu "Brandon" - Bioinformatics Program and Department of Chemistry, Boston University; Yu, Haiyuan - Department of Biological Statistics and Computational Biology, Cornell University |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 37 | Interrogating single proteins through nanopores: challenges and | ||
|
Summary: loop within the large vestibule of the aHL protein pore, a cavity with a volume of 39 500 A° 3 [18... Interrogating single proteins through nanopores: challenges and opportunities Liviu Movileanu1... . Moreover, groundwork in this area using engineered protein nanopores has demonstrated ... |
|||
|
Source: Movileanu, Liviu - Department of Physics, Syracuse University |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 38 | Connectivity and expression in protein networks: Proteins in a complex are uniformly expressed Shai Carmi,1 | ||
|
Summary: + A C + B C + C D + A B C + B C D = C0, A3 D + B D + C D + B C D = D0. A4 Denoting D0/A0, D D / , Eq. A4... = A . Substituting this into Eqs. A2 and A3 , one gets B + B C + + 1 A B 1 + C = B0, A6 C + B C + + 1 A C 1 + B = C0... Connectivity and expression in protein networks: ... |
|||
|
Source: Eisenberg, Eli - School of Physics and Astronomy, Tel Aviv University |
|||
|
Collection: Materials Science ; Physics |
|||
| 39 | Complementary Profiling of Gene Expression at the Transcriptome and Proteome Levels in | ||
|
Summary: hydroperoxide reductase 3 4.6 0.3 Yef3 Translation elongation factor EF-3A 3 2.1 0.4 Ald6 Cytosolic acetaldehyde... ratio of the messenger RNA transcript and the corresponding protein product were observed. Insights... into the perturbative effects on genes involved in respira- tion, energy generation, and ... |
|||
|
Source: Ideker, Trey G.- Department of Bioengineering, University of California at San Diego |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 40 | CLUSTERING METHODS IN PROTEIN-PROTEIN INTERACTION | ||
|
Summary: of weak or transient interactions. 1.1.2.3 Protein Microarray Microarray-based analysis is a relatively... CHAPTER 1 CLUSTERING METHODS IN PROTEIN-PROTEIN INTERACTION NETWORK Chuan Lin, Young-rae Cho, Woo... understanding of the expression, function, and regulation of the proteins encoded by an organism. It ... |
|||
|
Source: Buffalo, State University of New York - Department of Computer Science and Engineering, Bioinformatics, Database, Data Mining, and Multimedia Group |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 41 | Effect of Salt on the Urea-Unfolded Form of Barstar Probed by m Value Measurements | ||
|
Summary: .2 -1.14 0.9 1.1 K21A 3.4 -1.02 5.0 -1.10 6.1 -1.11 1.6 1.1 K78A 4.4 -1.02 6.0 -1.18 7.0 -1.16 1.6 1.0 K... in the protein (69) or weak binding of the ions to the protein (70). Debye theory cannot account for the large... ABSTRACT: To probe for residual structure present in the ... |
|||
|
Source: Udgaonkar, Jayant B. - National Centre for Biological Sciences, Tata Institute of Fundamental Research |
|||
|
Collection: Biology and Medicine |
|||
| 42 | J. Mol. Biol. (1996) 260, 588603 The Hydration of Globular Proteins as Derived from | ||
|
Summary: of van der Waals volumes, VW, (A° 3 ) for 12 proteins Protein Sc Sp Sn VM vM VW Hemoglobin 4248 5536 15... is the protein molecular mass, and VM is the intrinsic protein volume in A° 3 ); (4) the total accessible surface... ... |
|||
|
Source: Abagyan, Ruben - School of Pharmacy and Pharmaceutical Sciences, University of California at San Diego |
|||
|
Collection: Biology and Medicine |
|||
| 43 | Challenging Proteins Principles and Methods | ||
|
Summary: Purifying Challenging Proteins Principles and Methods GE Healthcare #12;2 Handbook 28-9095-31 AA... Gel Filtration Principles and Methods 18-1022-18 Recombinant Protein Purification Handbook Principles... and Methods 18-1142-75 Protein Purification Handbook 18-1132-29 Hydrophobic Interaction and Reversed Phase |
|||
|
Source: Lebendiker, Mario - Wolfson Centre for Applied Structural Biology, Hebrew University of Jerusalem |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 44 | N Biotechnol . Author manuscript Chimeric hepatitis B and C viruses envelope proteins can form subviral | ||
|
Summary: ( ). For all the three clones, fraction 9 (1.18 g/cm inFig. 5A 3 CsCl) corresponded to the peak fraction... N Biotechnol . Author manuscript Page /1 10 Chimeric hepatitis B and C viruses envelope proteins... The hepatitis B virus (HBV) envelope protein (S) self-assembles into subviral particles used as ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 45 | Structural Context of Exons in Protein Domains: Implications for Protein Modelling and Design | ||
|
Summary: London Research Institute Lincoln's Inn Fields Laboratories, 44 Lincoln's Inn Fields, London WC2A 3PX UK... coded by those genes, although this might have only weak connections to protein function. From... Structural Context of Exons in Protein Domains: Implications for ... |
|||
|
Source: Moreira, Bruno Contreras - Centro de Ciencias Genómicas, Universidad Nacional Autónoma de México |
|||
|
Collection: Biotechnology |
|||
| 46 | Protein Science (1997), 61653-1660. Cambridge University Press. Printed in the USA. Copyright 0 1997 The Protein Society | ||
|
Summary: a weakly acidic, pH 3.0. buffer. At this pH, the protein assumed a native-like conformation (see below... coefficient (Vm),is 2.14 A3/Da when calculated for a trimer of SIV gp412"'49 in the asymmetric unit... Protein Science (1997), 61653-1660. Cambridge University Press. Printed in the ... |
|||
|
Source: Clore, G. Marius - Laboratory of Chemical Physics. National Institutes of Health |
|||
|
Collection: Biology and Medicine |
|||
| 47 | Comparative proteomic and transcriptomic profiling of the fission yeast Schizosaccharomyces pombe | ||
|
Summary: .21) and the unfolded protein response (UPR) pathway (rP = 0.12), and rather weak for glycolytic enzymes (rP = 0... yeast / protein profiling / LC-MS/MS / relative protein quantification / mRNA-protein correlation... of predicted tryptic peptides, we have performed label-free ... |
|||
|
Source: Wolf, Dieter A.- Burnham Institute for Medical Research |
|||
|
Collection: Biology and Medicine |
|||
| 48 | Protein Structure and Function I. Form follows function-review of protein structure | ||
|
Summary: for ability to form weak interactions with a ligand! Binding site for cAMP in Catabolite Activator Protein... is exquisitely sensitive to the !G of just a few weak interactions! #12;Protein:protein interactions use the same... Protein Structure and Function I. Form follows function-review ... |
|||
|
Source: Lycan, Deborah E. - Department of Biology, Lewis and Clark College |
|||
|
Collection: Biology and Medicine |
|||
| 49 | Heterotrimeric G-proteins, composed of , and subunits, participate in a wide range of signaling pathways in eukaryotes (Morris and Malbon, 1999). According to the typical, mammalian paradigm, in its | ||
|
Summary: G() assemble with G into a heterotrimer. The functions A3 = GPA1 and not AGB1, A14 = not A3... Synopsis Heterotrimeric G-proteins, composed of , and subunits, participate in a wide range... , in its inactive state, the G-protein exists as an associated heterotrimer. ... |
|||
|
Source: Albert, Réka - Departments of Biology & Physics, Pennsylvania State University |
|||
|
Collection: Biology and Medicine |
|||
| 50 | Interactions of intermediate filament protein synemin with dystrophin and utrophin | ||
|
Summary: Ab) VIA4-2 A3 (IgM) was provided by Dr. Kevin P. Campbell's laboratory, desmin mAb was obtained from Sigma... , and blocked cells on coverslips were then incubated with anti-synemin 2856 pAb plus anti-dystrophin VIA4-2 A3... in the meth- ods. Avian synemin bound to His-fusion proteins R4 ... |
|||
|
Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa |
|||
|
Collection: Biology and Medicine |
|||
| 51 | MULTIPROSPECTOR: An Algorithm for the Prediction of ProteinProtein Interactions by Multimeric Threading | ||
|
Summary: electron transfer Homodimers 1A3C transcription regulation 1AJS aminotransferase 1ALO oxidoreductase 1AMK... Zx y d Zx y e Ef 1 1A3C 1A4X 95.9 7.2 7.8 37.2 2 1AJS 1AHE 38.1 9.2 10.8 153.9 3 1ALO 1FO4 19.1 7.9 8... MULTIPROSPECTOR: An Algorithm for the Prediction of ProteinProtein ... |
|||
|
Source: Lu, Hui - Department of Bioengineering, University of Illinois at Chicago; Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Biology and Medicine ; Biotechnology ; Chemistry ; Engineering |
|||
| 52 | APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Oct. 2002, p. 50825095 Vol. 68, No. 10 0099-2240/02/$04.00 0 DOI: 10.1128/AEM.68.10.50825095.2002 | ||
|
Summary: protein A3 precursor GerAC SW:GRAC_BACSU (P07870) (23.51 in 387 aa) and to B. subtilis spore germination... in amino acid metabolism. The first gene in the cluster, pBt101, encodes a protein with weak similarities... to diverse kinase proteins; the second, pBt102, is ... |
|||
|
Source: Zaritsky, Arieh - Department of Life Sciences, Ben-Gurion University |
|||
|
Collection: Biology and Medicine |
|||
| 53 | Jean-Paul Lasserre1 Emmanuelle Beyne2 | ||
|
Summary: 354 248 nusA C 2 P03003 Transcription elongation protein nusA 3.51 4.31 6.3 54 871 249 pckA C 36 P... ]. This result can be explained by the stoichiometry of the different subunits in the complex (a3b3gde). However... be strong or weak. 3.5 Identification of new ... |
|||
|
Source: Economou, Tassos - Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Hellas |
|||
|
Collection: Biology and Medicine |
|||
| 54 | Power and limitations of electrophoretic separations in proteomics Thierry. Rabilloud 1,2 | ||
|
Summary: of peptides. III.A.1. Capillary IEF III.A.2. Solution IEF III.A.3. IPG-IEF III.A.4. Off-Gel III.A.5. A new... immobilized in the IPG strips. III.A.3. IPG-IEF Loo and co-workers developed a bottom-up approach called... as the large-scale analysis of proteins. Due to the complexity of ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 55 | Benchmarking of TASSER in the Ab Initio Limit Jose M. Borreguero and Jeffrey Skolnick* | ||
|
Summary: also a linear correlation with TM score (RMSD $ 5.2 A° 3.8 A° ÁTM, r ¼ À0.66). Thus, while only a few... ;260:261276. 11. Zhang Y, Skolnick J. Automated structure prediction of weakly homologous proteins on a genomic... ABSTRACT A significant number of protein sequences in a ... |
|||
|
Source: Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 56 | Kinetics of an Individual Transmembrane Helix during Bacteriorhodopsin Folding | ||
|
Summary: contribution of A3 for the former, G113C-bimane, of 6% is similar to that of wild-type, ebO, intrinsic protein... fluorescence, where A3 contributes 9% of the corresponding protein fluorescence increase (i.e. the sum... of protein fluorescence ... |
|||
|
Source: Mason, Jody - Department of Biological Sciences, University of Essex |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 57 | 10 Fulton, D. et al. (1999) Regulation of endothelium-derived nitric oxide production by the protein | ||
|
Summary: slow in recognizing the importance of these weak hydrogen bonds for proteins, although some papers... .K. and Petsko, G.A. (1988) Weakly polar interactions in proteins. Adv. Prot. Chem. 39, 125189 9 Pearson, R... residues in PLC are involved in disulfide bridges. edCA ... |
|||
|
Source: Pal, Debnath - Supercomputer Education and Research Centre, Indian Institute of Science |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 58 | 10.1101/gr.473902Access the most recent version at doi: 2002 12: 1231-1245; originally published online Jul 19, 2002;Genome Res. | ||
|
Summary: protein Similar to hnRNP A3 ENSP00000301786 Hypothetical protein Similar to hnRNP U ENSP000000301784... - ambiguous charge state determination. Figure 1, panels A3, B3, and C3 contain the fragment ion spectra... peptides coelute. (Insets) Zoom of the peak marked with ... |
|||
|
Source: Lamond, Angus I. - Wellcome Trust Centre for Gene Regulation and Expression, University of Dundee |
|||
|
Collection: Biology and Medicine |
|||
| 59 | AcFKH1, a novel member of the forkhead family, associates with the RFX transcription factor CPCR1 in the cephalosporin C-producing fungus | ||
|
Summary: For our investigations we used A. chrysogenum strains ATCC 14553 and the semi-producer strain A3/2 (Radzio... the CPCR1 protein fragments, only fragment C1 stimulated slight reporter gene activation, suggesting a weak... potential protein interaction partners. A cDNA was identified, ... |
|||
|
Source: Kück, Ulrich - Fakultät für Biologie, Ruhr-Universität Bochum |
|||
|
Collection: Biology and Medicine |
|||
| 60 | 6286 Phys. Chem. Chem. Phys., 2011, 13, 62866295 This journal is c the Owner Societies 2011 Cite this: Phys. Chem. Chem. Phys., 2011, 13, 62866295 | ||
|
Summary: in the presence of a weak field. In the all-atom molecular dynamics simulations of proteins described below... Societies 2011 Here, F = 2(e1 À 1)/((2e1 + 1)a3 ), a is the total electronic polarizability of the cavity... in the cavity: Fout ¼ ÀEext Á r þ a3 r r3 ... |
|||
|
Source: Plotkin, Steven S. - Department of Physics and Astronomy, University of British Columbia |
|||
|
Collection: Biology and Medicine ; Physics |
|||
| 61 | Tertiary Structure Predictions on a Comprehensive Benchmark of Medium to Large Size Proteins | ||
|
Summary: the applicability of an approach to weakly/nonhomologous proteins, such homologous struc- tures should be carefully... .1/0.89 A° , 3.3/3.1 A° , and 5.3/5.2 A° with full-length/aligned regions, respectively. These data show... on weak sequence fragment similarity. ... |
|||
|
Source: Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 62 | COMMUNICATION The Constraints ProteinProtein Interactions Place on | ||
|
Summary: these are systematically weakly conserved proteins, the conclusions of this work are not affected, and there is no reason... COMMUNICATION The Constraints ProteinProtein Interactions Place on Sequence Divergence Sarah A... on a small number of protein families have shown that residues in ... |
|||
|
Source: Teichmann, Sarah - Laboratory of Molecular Biology, MRC |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 63 | 10.1110/ps.0232903Access the most recent version at doi: 2003 12: 1177-1187Protein Sci. | ||
|
Summary: rhe 1nmaH 1bmg 1iluH 1fupA 3-20 20-43 5-21 85-112 81-101 78 (52) 53 (39) 52 (35) 46 (21) 60 (38... 10.1110/ps.0232903Access the most recent version at doi: 2003 12: 1177-1187Protein Sci. Nurit... the computational complexity of protein folding via References http://www.proteinscience.org/cgi/content/full/12 |
|||
|
Source: Haspel, Nurit - Department of Computer Science, University of Massachusetts at Boston |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 64 | Structure of Membrane-Embedded M13 Major Coat Protein Is Insensitive to Hydrophobic Stress | ||
|
Summary: , and will not contribute to the energy transfer processes. M13 coat protein mutant A3C was selected, because the AEDANS... A3C at different lipid/protein ratios for 14:1PC ()) and 20:1PC membranes (d). The concentration... mismatch. METHODS Sample preparation Single ... |
|||
|
Source: Hemminga, Marcus A. - Department of Molecular Physics, Wageningen Universiteit |
|||
|
Collection: Physics ; Biology and Medicine |
|||
| 65 | Prediction of Protein Interaction Sites From Sequence Profile and Residue Neighbor List | ||
|
Summary: :proproteinase E 0.6 0 -- 2 50 1pytC:A 1fonA 3.2 10 70 23 26 1qctA:B 1afcA growth factor:growth factor receptor 0... Prediction of Protein Interaction Sites From Sequence Profile and Residue Neighbor List Huan... Proteinprotein interaction sites are predicted from a neural network with sequence profiles |
|||
|
Source: Weston, Ken - Department of Chemistry and Biochemistry, Florida State University |
|||
|
Collection: Chemistry |
|||
| 66 | In Silico Prediction of the Peroxisomal Proteome in Fungi, Plants and Animals | ||
|
Summary: retrieved candi- dates for bi-functional protein 2 enzyme (DBP) (A3b) both in Caenorhabditis elegans... -CoA_dh_M] [Acyl-CoA_dh] [ACOX] A3a LBP (Bifunctional protein) [ECH] b-Oxidation 0 0 3 2 1 1 1 1 3HCDH_N [TrkA-N] 3... HCDH ... |
|||
|
Source: Elofsson, Arne - Stockholm Bioinformatics Center, Stockholms Universitet |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 67 | The interaction of MI3 1 coat protein with upid bilayers | ||
|
Summary: composition of the protein in this form. The second derivative of this spectrum shows weak bands in the amide... .,. ;", E all The interaction of MI3 1 I %LL coat protein with upid bilayers 9 1 - ;% - , b - I... a spectroscopic study J.C. Sanders #12;#12;The interaction of MI3 coat protein with lipid bilayers ... |
|||
|
Source: Hemminga, Marcus A. - Department of Molecular Physics, Wageningen Universiteit |
|||
|
Collection: Physics ; Biology and Medicine |
|||
| 68 | J. Phys. II France 6 (1996) 10231047 JULY 1996, PAGE 1023 Protein Adsorption on Lipid Monolayers | ||
|
Summary: for the symmetric case, c = 0, which is given by = 9J3/2 g 1/2 2L a(1 - 5a/3) - (1 - a)2 tanh-1 ( a) (74... J. Phys. II France 6 (1996) 10231047 JULY 1996, PAGE 1023 Protein Adsorption on Lipid Monolayers... Abstract. -- We investigate theoretically the behavior of proteins as well as other large macro- ... |
|||
|
Source: Andelman, David - School of Physics and Astronomy, Tel Aviv University |
|||
|
Collection: Materials Science ; Physics |
|||
| 69 | Practical aspects of overexpressing bacterial secondary membrane transporters for structural studies | ||
|
Summary: level and purification yield Activity assay Comments APC (2.A.3) GabP Escherichia coli E. coli LMG194, p... proteins. Therefore, the selection of the high- expression colonies is not affected by the weak false... 2002 Abstract Membrane transporter proteins play critical physiological ... |
|||
|
Source: Wang, Da-Neng - Skirball Institute of Biomolecular Medicine & Department of Cell Biology, New York University |
|||
|
Collection: Biology and Medicine |
|||
| 70 | Amino acids equivalences within protein structures The original publication is available at www.springerlink.com | ||
|
Summary: 1a+1b, 2a+2b and 3a+3b of Table I) show that the cluster 1 is the most stable because sub-clusters 1... of amino acid clusters for each PB. cluster 1 cluster 2 cluster 3 1a 1b 2a 2b 3a 3b PB IV FYW 1a+1b. ALM... EQRK 2a+2b. ND HSTC 3a+3b. aa differences major ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 71 | Viscosity-Dependent Protein Dynamics Ilya J. Finkelstein, Aaron M. Massari, and M. D. Fayer | ||
|
Summary: labeled as A3, A1, and A0 (very small) can be observed at 1934, 1944, and 1968 cmÀ1 , respectively. In Hb... 61A at Tw ¼ 2 ps as a function of viscosity. The peak shifts of the A1 and A3 states of Mb... correlation times, the contribution from the partially overlapping ... |
|||
|
Source: Fayer, Michael D. - Department of Chemistry, Stanford University |
|||
|
Collection: Chemistry |
|||
| 72 | Convergent evolution of protein structure | ||
|
Summary: Convergent evolution of protein structure prediction and computer chess tournaments: CASP, Kasparov... , and CAFASP by N. Siew D. Fischer Predicting the three-dimensional structure of a protein from its amino acid... , we review in brief the current state of protein structure prediction and describe what has been |
|||
|
Source: Fischer, Daniel - Center of Excellence in Bioinformatics and Life Sciences & Department of Computer Science and Engineering, State University of New York at Buffalo |
|||
|
Collection: Computer Technologies and Information Sciences ; Biotechnology ; Biology and Medicine |
|||
| 73 | DNA packaging intermediates of bacteriophage X174 Leodevico LIlagit, Norman H Olson1, Terje Dokland1, Cynthia LMusic1, | ||
|
Summary: mass of the virion based on a protein density of 1.23 A3 Da'. The cutoff level determined in this way... . The function of the scaffolding proteins may be, in part, to support weak interactions between the structural... ) 293 A External (along five-fold axis) 335 A 355 A Internal volume 5x ... |
|||
|
Source: Baker, Timothy S. - Department of Chemistry and Biochemistry, University of California at San Diego |
|||
|
Collection: Biology and Medicine |
|||
| 74 | J. Phys. II France 6 (1996) 1023-1047 JULY 1996, PAGE1o23 Protein Adsorption on | ||
|
Summary: present the solution for the symmetric case, c = 0, which is given by Tj = ~~~/~~~ (vi(1 5a/3) (1 a)~ tanh... J. Phys. II France 6 (1996) 1023-1047 JULY 1996, PAGE1o23 Protein Adsorption on Lipid Monolayers... . We investigate theoretically the behavior of proteins as well as other large macro- molecules which |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 75 | SHORT COMMUNICATION Development and Benchmarking of TASSERiter | ||
|
Summary: /3 of proteins that are at weakly homologous to proteins in the PDB, appropriate templates cannot be identified... - and weakly homologous proteins <200 residues in length28 and provided models of significantly higher accuracy... than those of the initial threading templates. One-third ... |
|||
|
Source: Skolnick, Jeff - Center for the Study of Systems Biology, Georgia Institute of Technology |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 76 | 10.1110/ps.062687207Access the most recent version at doi: 2007 16: 1001-1008Protein Sci. | ||
|
Summary: -type ssTorA showed growth after 4 d, consistent with the phenotype observed on MacConkey plates (Fig. 2A3... 10.1110/ps.062687207Access the most recent version at doi: 2007 16: 1001-1008Protein Sci. Eva... http://www.proteinscience.org/subscriptions/ go to:Protein ScienceTo subscribe to © 2007 Cold Spring |
|||
|
Source: Georgiou, George - Departments of Biomedical Engineering, & Chemical Engineering, University of Texas at Austin |
|||
|
Collection: Engineering ; Biotechnology |
|||
| 77 | Enhanced monomermonomer interactions can suppress the recombination deciency of the | ||
|
Summary: the cells (Fig. 3). Interestingly, death occurred even though the strain contains two mutations [lexA3, s... , media and growth conditions All strains used in this study are listed in Table 3. EZ1996 (lexA3 s®A11... DrecA306::Tn10 A. J. Clark's collection DM1623 ... |
|||
|
Source: Kowalczykowski, Stephen C. - Section of Microbiology, University of California, Davis |
|||
|
Collection: Biology and Medicine |
|||
| 78 | This article appeared in a journal published by Elsevier. The attached copy is furnished to the author for internal non-commercial research | ||
|
Summary: this weakness of approaches based on the coevolution principle. For each protein u, Juan et al. compute a vector... the reliability of protein interactomes Hon Nian Chua1 and Limsoon Wong2 1 Institute for Infocomm Research, 21... of Computing, Singapore 117590, Singapore Protein interactions are crucial ... |
|||
|
Source: Wong, Limsoon - Department of Computational Science, National University of Singapore |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 79 | MOLECULAR AND CELLULAR BIOLOGY, Feb. 2011, p. 793802 Vol. 31, No. 4 0270-7306/11/$12.00 doi:10.1128/MCB.01117-10 | ||
|
Summary: gctgca gtcgac ttcgcg tacacc atcagg gtacgA-3 and 5 -Tcgtac cctgat ggtgta cgcgaa gtcgac tgcagc gtaccc... .1128/MCB.01117-10 Copyright © 2011, American Society for Microbiology. All Rights Reserved. SR Proteins... /Returned for modification 26 October 2010/Accepted 29 November 2010 SR proteins are well known to ... |
|||
|
Source: Hertel, Klemens J. - Department of Microbiology and Molecular Genetics, University of California, Irvine |
|||
|
Collection: Biology and Medicine |
|||
| 80 | Survey for G-Proteins in the Prokaryotic Genomes: Prediction of Functional Roles Based on Classification | ||
|
Summary: . EngA 3. TrmE/ThdF 4. Hypothetical GTP binding protein GTP_OBG -subunit of heterotrimeric G-protein... Survey for G-Proteins in the Prokaryotic Genomes: Prediction of Functional Roles Based... , Bangalore, India ABSTRACT The members of the family of G- proteins are ... |
|||
|
Source: Srinivasan, N. - Molecular Biophysics Unit, Indian Institute of Science, Bangalore |
|||
|
Collection: Biology and Medicine |
|||
| 81 | MOLECULAR AND CELLULAR BIOLOGY, Aug. 1996, p. 43784386 Vol. 16, No. 8 0270-7306/96/$04.00 0 | ||
|
Summary: secretory protein -F in a1-45 a2 a3 a4 mutants. Prepro- -F (pp -F) contains a signal sequence specific... - ture. a1-45 a2 a3 a4 and ydj1 are synthetically lethal. Several DnaJ-like proteins have been identified... of the translocation of pro- teins into the ER. a1-45 ... |
|||
|
Source: Craig, Elizabeth A - Department of Biochemistry, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine |
|||
| 82 | This manuscript has been published online in Molecular and Cellular Proteomics (Dec 2006) -doi:10.1074/mcp.M600250-MCP200 | ||
|
Summary: , a proteomic approach was developed in order to identify the protein components present in both the membrane... sulfoxide, (ii) an in-solution proteolytic digestion of very hydrophobic proteins, (iii) a pre... -fractionation of proteins by short migration on SDS-PAGE followed by analysis by liquid chromatography coupled to tandem |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 83 | HEMATOPOIESIS Genomic and proteomic analysis of the myeloid differentiation program: global | ||
|
Summary: between mRNA and protein levels during MRPO cell maturation. Previous studies in yeast showed weak... , IIIf5, Pbp, Spry1 Transcription modulators Hmgb1, Hmg2, KRZF80M, Rnf17, Stat5a, Taf2e, Zfp101, ZFP1A3... of the temporal patterns of protein and mRNA expression during myeloid ... |
|||
|
Source: Gerstein, Mark - Department of Molecular Biophysics and Biochemistry, Yale University |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 84 | Mapping RNA-Protein Interactions in Ribonuclease P from Escherichia coli using Disulfide-linked EDTA-Fe | ||
|
Summary: not shown). Consistent with this observation, the tertiary structure of C5 protein places Cys113 (in a3... is performed with the underivatized protein, the hydroxyl radical-mediated cleavages in M1 RNA are either weak... Mapping RNA-Protein Interactions in ... |
|||
|
Source: Gopalan, Venkat - Departments of Biochemistry & Plant Biology, Ohio State University |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 85 | 2007 Annual progress report synopsis of the Center for Structures of Membrane Proteins | ||
|
Summary: 2007 Annual progress report synopsis of the Center for Structures of Membrane Proteins Robert M... A synopsis of the 2007 annual progress report for the Center for Structures of Membrane Proteins... , a specialized center of the Protein Structure Initiative. Keywords Membrane proteins Á Structural biology Á ... |
|||
|
Source: Sali, Andrej - Department of Biochemistry and Biophysics, University of California at San Francisco |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 86 | GE Healthcare Life Sciences | ||
|
Summary: GE Healthcare Life Sciences imagination at work magination at work Protein Sample Preparation... and Applications 18-1115-69 Purifying Challenging Proteins Principles and Methods 28-9095-31 Isolation... Dictor Plates Principles and Methods 28-9403-58 Protein Sample Preparation Handbook 28-9887-41 Gel Filtration |
|||
|
Source: Lebendiker, Mario - Wolfson Centre for Applied Structural Biology, Hebrew University of Jerusalem |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 87 | 10.1110/ps.062185706Access the most recent version at doi: 2006 15: 1557-1562; originally published online May 2, 2006;Protein Sci. | ||
|
Summary: (nonsignificant e-value of $100). The cluster combines GRFa (marked Q9Z2A3 and Q9Z2A2 from mouse, GFR2_CHICK, GFR2... online May 2, 2006;Protein Sci. Ori Sasson, Noam Kaplan and Michal Linial Functional annotation... - sign up in the box at the Notes http://www.proteinscience.org/subscriptions/ go to:Protein ... |
|||
|
Source: Linial, Michal - Sudarsky Center for Computational Biology & Department of Biological Chemistry, Hebrew University of Jerusalem |
|||
|
Collection: Biology and Medicine |
|||
| 88 | NMR Structure of Mistic, a Membrane-Integrating Protein | ||
|
Summary: with weak promoters to produce low levels of protein, compensated by large culture volumes (2). Truncated... and a3, as well as the C terminus of Mistic, are more mobile. The T1/T2 ratio of 15N was used... NMR Structure of Mistic, a Membrane-Integrating Protein for Membrane ... |
|||
|
Source: Riek, Roland - Structural Biology Laboratory, Salk Institute for Biological Studies |
|||
|
Collection: Biology and Medicine ; Chemistry |
|||
| 89 | Vol. 22 no. 11 2006, pages 13431352 doi:10.1093/bioinformatics/btl098BIOINFORMATICS ORIGINAL PAPER | ||
|
Summary: .e. starts from a mismatch cell) going from cell (A3,B1) to (A4,B3). This illustrates an alignment in which... we disregard the atoms B1 and B2 and align cells (A3,B0) and (A4,B3) one after the other... in the alignment. Because cell (A3,B1) is a mismatch and cell ... |
|||
|
Source: Haspel, Nurit - Department of Computer Science, University of Massachusetts at Boston |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 90 | JOURNALDE PHYSIQUE IV ColloqueC4, supplement au Journal de Physique 11,Volume 3, septembre 1993 | ||
|
Summary: are distributed over a range of values from 25 A3to 150 A3, The average cavity volume in the dry protein is about... 65 A3. This shifts to about 90 A3 on hydration. The o-Ps fraction is 0.17 - 0.18 in the ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 91 | The Plant Cell, Vol. 11, 23932405, December 1999, www.plantcell.org 1999 American Society of Plant Physiologists Novel Protein Kinases Associated with Calcineurin Blike | ||
|
Summary: ,c Sheng Luan,a,3 and Jörg Kudlab a Department of Plant and Microbial Biology, University of California... CBL proteins retain structural do- mains responsible for a weak interaction with an animal cal- cineurin... of Plant Physiologists Novel Protein Kinases Associated with Calcineurin ... |
|||
|
Source: Luan, Sheng - Department of Plant and Microbial Biology, University of California at Berkeley |
|||
|
Collection: Biology and Medicine |
|||
| 92 | Advances in Molecr~larBioinforararics S. Sch~tlze-Krenm(Ed.j | ||
|
Summary: MEKHRKTGIRVEKGPKFKRDIFGQNKREAECYNWNKEKDFKIQPGKAYKKDPEIQGKAVKEKEKEKDEKRK - --A' 3l MEKDKRTGIKVQRGVKFSKDLAGQTRKDPEIYHFYKNKNFKIHCGKASRKDPQITGRAVKEKEKEKNPWTK 11 H E K H P K... for the Design of Proteins MRC Laboratory ofMolemhr Biology, Hilk Road, CambridgeCBZ ZQH, U K Department of... Biochemistry, Universityof ... |
|||
|
Source: Brenner, Steven E. - Department of Plant and Microbial Biology, University of California at Berkeley |
|||
|
Collection: Biotechnology |
|||
| 93 | Molecular Biology 311 Problem set 1 | ||
|
Summary: choose to delete the one from the protein in A. 3. A. None are detected in this experiment-see lane 2... a stretch of six histidines to either the N-terminus or the C-terminus of your protein are illustrated below... to find out what protein is being modified in this problem. CAC can ... |
|||
|
Source: Lycan, Deborah E. - Department of Biology, Lewis and Clark College |
|||
|
Collection: Biology and Medicine |
|||
| 94 | FOR THE RECORD Association and dissociation kinetics of colicin E3 and | ||
|
Summary: B-, then the linked variant has as- sociation and dissociation rate constants: ka = kA+ + kB+ = kA+ 1 + kB+ kA+ ( 3a... FOR THE RECORD Association and dissociation kinetics of colicin E3 and immunity protein 3... immunity protein Im3 is essential in safeguarding the producing cell. The X-ray structure of the ... |
|||
|
Source: Weston, Ken - Department of Chemistry and Biochemistry, Florida State University |
|||
|
Collection: Chemistry |
|||
| 95 | J protein cochaperone of the mitochondrial inner membrane required for protein import into the | ||
|
Summary: with alanines (Pam18A3). In addition, we constructed a mutation that results in a substitution of a glu- tamine... J protein cochaperone of the mitochondrial inner membrane required for protein import... in yeast) is critically important for the translocation of proteins from the cytosol, ... |
|||
|
Source: Craig, Elizabeth A - Department of Biochemistry, University of Wisconsin at Madison; D' Silva, Patrick - Department of Biochemistry, Indian Institute of Science, Bangalore |
|||
|
Collection: Biology and Medicine |
|||
| 96 | Can a Pairwise Contact Potential Stabilize Native Protein Folds Against Decoys Obtained by Threading? | ||
|
Summary: -sheet 27 1ext A, 3ebx, 1cka A, 1ova A, 1arb, 1hbq, 1hyl A, 1ida A, 1ifc, 1lid, 4fgf, 1kap P, 1lop A, 1... Can a Pairwise Contact Potential Stabilize Native Protein Folds Against Decoys Obtained... energy parameters from large sets of proteins. The basic requirement on which our method is based |
|||
|
Source: Najmanovich, Rafael - European Bioinformatics Institute, Wellcome Trust Genome Campus Cambridge |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 97 | Protein Chemistry DOI: 10.1002/anie.200501023 | ||
|
Summary: for ubiquitylation at Lys side chains. Figure 6. a) 3D trace of the 76-residue ubiquitin: Lys29,48,63 side chains... Protein Chemistry DOI: 10.1002/anie.200501023 Protein Posttranslational Modifications... , Jr. Angewandte Chemie Keywords: amino acids · enzymes · protein modifications · ... |
|||
|
Source: Walsh, Christopher T.- Department of Biological Chemistry and Molecular Pharmacology, Harvard University |
|||
|
Collection: Biology and Medicine |
|||
| 98 | Summary and concluding ESEARCH on the structure and function of substrate-binding proteins (SBPs) | ||
|
Summary: within a voluminous cavity of almost 5000 °A3. The peptide termini were not fixed with salt... -binding proteins (SBPs) of ATP Binding Cassette (ABC) transporters has been ongoing for at least four decades. Our... understanding of these proteins expanded drastically in the 1980s and 1990s when a large number ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 99 | Provided for non-commercial research and educational use only. Not for reproduction, distribution or commercial use. | ||
|
Summary: ., 2005).(A)3-ATresistance increasesas Kd decreases. (B)b-Galactosidase activity(relative light units... . Stumpf, Laura Opperman, and Marvin Wickens, Analysis of RNAProtein Interactions Using a Yeast Three... . #12;C H A P T E R F O U R T E E N Analysis of RNAProtein Interactions Using a Yeast Three |
|||
|
Source: Wickens, Marv - Department of Biochemistry, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine |
|||
| 100 | RESEARCH ARTICLE Open Access The venom composition of the parasitic wasp | ||
|
Summary: Bank:AAA27730.1] Apis mellifera 46 7e-07 A3YM10CM1 FN985042 Hyaluronidase 2 [GenBank:AAK51798.2] Apis cerana... are well documented, relatively little is known at the molecular level on the protein composition... of these secretions. To identify the majority of the venom proteins of the endoparasitoid wasp ... |
|||
|
Source: Lanzrein, Beatrice - Institut für Zellbiologie, Universität Bern |
|||
|
Collection: Biology and Medicine |
|||