| Sample search results for: abc transporter pdr5 |
| 1 | Genome Biology 2004, 5:R15 commentreviewsreportsdepositedresearchrefereedresearchinteractionsinformation | ||
|
Summary: commentreviewsreportsdepositedresearchrefereedresearchinteractionsinformation Open Access2004Shepset al.Volume 5, Issue 3, Article R15Research The ABC transporter gene family... purpose, provided this notice is preserved along with the article's original URL. The ABC transporter gene... severalgene families ... |
|||
|
Source: Baillie, David - Department of Molecular Biology and Biochemistry, Simon Fraser University |
|||
|
Collection: Biology and Medicine |
|||
| 2 | ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Sept. 2003, p. 27252731 Vol. 47, No. 9 0066-4804/03/$08.00 0 DOI: 10.1128/AAC.47.9.27252731.2003 | ||
|
Summary: , Pdr5p, Pdr10p, Pdr11p, Ycf1p, and Pdr15p are ABC transporters (reviewed in reference 16). These plasma... membrane transporters, especially Pdr5p and Snq2p, mediate the ATP-dependent efflux of a large number... . This was observed for other ... |
|||
|
Source: Trumpower, Bernard L. - Department of Biochemistry, Dartmouth College |
|||
|
Collection: Biology and Medicine |
|||
| 3 | ABC transporters ABC transporter architecture and regulatory roles of | ||
|
Summary: and 2, and PDR5), and the ABC type chloride channel CFTR (Fig. 1D), and these are termed "full... /3), human peptide transporter; PDR5, yeast pleiotropic drug resistance transporter; P-gp (MDR1/ABCB1), human... ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 4 | Molecular Microbiology (2004) 53(1), 335344 doi:10.1111/j.1365-2958.2004.04134.x 2004 Blackwell Publishing Ltd | ||
|
Summary: of a number of genes involved in PDR, including those encod- ing the ABC transporters Pdr5 andYor1 (Balzi et... for normal expression of the ATP binding cassette transporter protein-encoding gene PDR5. J Biol Chem 271... with unrelated structure ... |
|||
|
Source: Craig, Elizabeth A - Department of Biochemistry, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine |
|||
| 5 | Candida Drug Resistance Protein 1, a Major Multidrug ATP Binding Cassette Transporter of Candida albicans, Translocates Fluorescent Phospholipids in a | ||
|
Summary: ABC transporters Pdr5p and Yor1p likely translocate the fluorescent PE analogue NBD-PE at the plasma... transporters such as the S. cereVisiae proteins Pdr5p and Yor1p and the C. albicans proteins Cdr1p-Cdr4p can... . Overexpression of the ... |
|||
|
Source: Menon, Anant K. - Menon Lab, Weill Medical College, Cornell University |
|||
|
Collection: Biology and Medicine |
|||
| 6 | Function of prokaryotic and eukaryotic ABC proteins in lipid transport Antje Pohla,b | ||
|
Summary: Review Function of prokaryotic and eukaryotic ABC proteins in lipid transport Antje Pohla... of the ABC protein families A, B, C, D and G are mutated in a number of lipid transport and metabolism... and further transport to specific sites. Additionally, lipid ... |
|||
|
Source: Institut de Biologie Physico-Chimique CNRS, Physico-Chimie Moléculaire des Membranes Biologiques |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 7 | nAture methods | VOL.8 NO.2 | FEBRUARY2011 | 159 Phenotypes that might otherwise reveal a gene's function | ||
|
Summary: . This suggests the existence of one or two major transporters for each drug (for example, Pdr5p and Pdr11p... sensitivity (Fig. 3b,c). This suggests that transporters other than Pdr5p are involved in transporting... ., Kolaczkowski, M., Goffeau, ... |
|||
|
Source: Harvard University, Center for Cancer Systems Biology; Roth, Frederick - Department of Biological Chemistry and Molecular Pharmacology, Harvard University |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 8 | EUKARYOTIC CELL, Aug. 2006, p. 12431251 Vol. 5, No. 8 1535-9778/06/$08.00 0 doi:10.1128/EC.00048-06 | ||
|
Summary: as substrates of the yeast multidrug transporter Pdr5p. J. Biol. Chem. 271:3154331548. 14. Kontoyiannis, D. P... of fluconazole tested. In genome-wide assays of gene expression, several ABC transporter genes that were... ABC transporters. At ... |
|||
|
Source: Anderson, James B. - Department of Ecology and Evolutionary Biology, University of Toronto |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 9 | Oligomerization of the Human ABC Transporter ABCG2: Evaluation of the Native Protein and Chimeric Dimers | ||
|
Summary: - ESSEEESDTYGEIGLSKSEAIFHWRNLCYEVQIKAE- PR) derived from the flexible linker region of yeast ABC transporter PDR5. The linkers from both... Oligomerization of the Human ABC Transporter ABCG2: Evaluation of the Native Protein and Chimeric... of the ATP binding cassette ... |
|||
|
Source: Hrycyna, Christine A. - Department of Chemistry, Purdue University |
|||
|
Collection: Biology and Medicine ; Chemistry |
|||
| 10 | pour obtenir le titre de DOCTEUR de l'ECOLE POLYTECHNIQUE | ||
|
Summary: fusionnés génétiquement dans l'ordre : NBD1-TMD1-NBD2-TMD2 (ex. la protéine Pdr5p de Saccharomyces... - Chami et al., 2002 Pdr5p Saccharomyces cerevisiae transporteur de produits toxiques ~25 Å - Ferreira... détoxication de la levure par les transporteurs ABC : 1 - étude ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 11 | A nuclear receptor-like pathway regulating multidrug resistance in fungi | ||
|
Summary: , C. & Kuchler, K. Expression regulation of the yeast PDR5 ATP-binding cassette (ABC) transporter... through transcriptional activa- tion of ABC transporter genes and members of the major facilitator... superfamily of drug efflux pumps, including ... |
|||
|
Source: |
|||
|
Collection: Biology and Medicine |
|||
| 12 | Functional hot spots in human ATP-binding cassette transporter | ||
|
Summary: (ABC) transporter superfamily consists of 48 integral membrane proteins that couple the action of ATP... of the majority of ABC transporter nsSNPs has yet to be experimentally characterized. Here, we combine... ABC transporters. First, the disease associations of 39 ... |
|||
|
Source: Sali, Andrej - Department of Biochemistry and Biophysics, University of California at San Francisco |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 13 | Copyright 2003 by the Genetics Society of America Mode of Selection and Experimental Evolution of Antifungal Drug Resistance | ||
|
Summary: in the overexpression of the ABC transporter genes PDR5 and SNQ2. These mutations had an unexpected pleiotropic effect... . In the cross with the PDR3 knockoutABC transporter genes PDR5 and SNQ2, three- to four- strain, all ... |
|||
|
Source: Anderson, James B. - Department of Ecology and Evolutionary Biology, University of Toronto; Kohn, Linda M. - Department of Ecology and Evolutionary Biology, University of Toronto |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 14 | Copyright 2004 by the Genetics Society of America DOI: 10.1534/genetics.104.033266 | ||
|
Summary: in the genes PDR1 and PDR3, which regulate the ABC transporters implicated in resistance to fluconazole... expected, expression of two genes, PDR5 and ERGll, was monitored in experimental cultures at day 5 and... of mating in some cases at day 9. Overexpression of ... |
|||
|
Source: Anderson, James B. - Department of Ecology and Evolutionary Biology, University of Toronto |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 15 | Molecular Biology of the Cell Vol. 14, 12401254, March 2003 | ||
|
Summary: , 2001) and depend on expression of the yeast ABC transporters Pdr5p and Yor1p (Decottignies et al., 1998... -PE across the plasma membrane (Figures 3 and 5), removal of the ABC transporters Pdr5p and Yor1p from... ... |
|||
|
Source: Institut de Biologie Physico-Chimique CNRS, Physico-Chimie Moléculaire des Membranes Biologiques |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 16 | 936 volume 5 number 12 december 2009 nature chemical biology a r t i c l e s | ||
|
Summary: occurred in vivo. Overexpressing NM-YFP in [psi-] pdr5 cells (which lack Pdr5, an ABC transporter... ± s.d. (n = 3). (f) NM-YFP was overexpressed in [psi-] pdr5 cells for 12 h in the presence of DMSO (1... and several new ... |
|||
|
Source: Shorter, James - Department of Biochemistry and Biophysics, University of Pennsylvania |
|||
|
Collection: Biology and Medicine |
|||
| 17 | Membrane trafficking of yeast transporters: mechanisms and physiological control of downregulation | ||
|
Summary: et al. 1997), the ABC transporter Pdr5p (Plemper et al. 1998), the a-factor transporter Ste6p (Loayza... , and the role of the Yck kinases does not seem to be simple. The ABC transporter, Pdr5p, which has ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 18 | ABC transporters: Lessons from a bacterial oligopeptide uptake system | ||
|
Summary: -drug transporters (e.g., P-gp, MRP1 and 2, and PDR5), and the ABC type chloride channel CFTR (Fig. 1D... /3), human peptide transporter; PDR5, yeast pleiotropic drug resistance transporter; P-gp (MDR1/ABCB1), human... ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 19 | RESEARCH Open Access Evolutionary divergence in the fungal response | ||
|
Summary: ,42,43]. Of these, we found that the PDR5/10/15 family of ABC transporters was up-regulated in Cg and Sc but not Kl... not in the presence of serum) [49]. Third, deletion of the Cg orthologs of fluconazole transporters PDR5 (CgCDR1) [50... (Figure ... |
|||
|
Source: Ideker, Trey G.- Department of Bioengineering, University of California at San Diego |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 20 | ABC transporters: Lessons from a bacterial oligopeptide uptake system | ||
|
Summary: ABC transporters: Lessons from a bacterial oligopeptide uptake system Mark K. Doeven #12;Cover... by PrintPartners Ipskamp, Enschede #12;RIJKSUNIVERSITEIT GRONINGEN ABC transporters: Lessons from... A determines the selectivity of the oligopeptide ABC transporter 35 ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 21 | Nederlandse samenvatting Nederlandse samenvatting voor genteresseerden buiten | ||
|
Summary: vakgebied Samenvatting ABC transporters zijn eiwitten die betrokken zijn bij de opname van voedingsstoffen... en uitscheiding van schadelijke stoffen in de biologische cel. Defecten in ABC transporters kunnen... bij de mens ernstige ziektes tot gevolg hebben. Te grote activiteit van ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 22 | Direct and selective elimination of specific prions and amyloids by 4,5-dianilinophthalimide and analogs | ||
|
Summary: , we examined their [PSI ]-curing ability. We used a strain lacking the ABC transporter, Pdr5, which... pumps small molecules out of the cell. PDR5 cells stably propa- gated [PSI ] (Fig. 4C). DMSO ( 5%) cures... transformants was determined. Values are means SD (n 3). ... |
|||
|
Source: Duennwald, Martin L. - Boston Biomedical Research Institute; Shorter, James - Department of Biochemistry and Biophysics, University of Pennsylvania |
|||
|
Collection: Biology and Medicine |
|||
| 23 | 2009-taebc ABC-Clio ebooks collection 1203titles ISBN URL | ||
|
Summary: 2009-taebc ABC-Clio ebooks collection 1203titles ISBN URL 1 Arts & Humanities Acquisitions... Bastian, Jeannette Allis Libraries Unlimited Ebooks 2003 http://ebooks.abc- clio.com/?isbn=9780313052378 2... Libraries Unlimited Ebooks 2007 http://ebooks.abc- clio.com/?isbn=9780313094521 3 Arts & Humanities |
|||
|
Source: Wu, Yih-Min - Department of Geosciences, National Taiwan University |
|||
|
Collection: Geosciences |
|||
| 24 | 936 volume 5 number 12 december 2009 nature chemical biology a r t i c l e s | ||
|
Summary: occurred in vivo. Overexpressing NM-YFP in [psi-] pdr5 cells (which lack Pdr5, an ABC transporter... ± s.d. (n = 3). (f) NM-YFP was overexpressed in [psi-] pdr5 cells for 12 h in the presence of DMSO (1... and several new ... |
|||
|
Source: Shorter, James - Department of Biochemistry and Biophysics, University of Pennsylvania |
|||
|
Collection: Biology and Medicine |
|||
| 25 | Applied Mathematics Letters 24 (2011) 12511256 Contents lists available at ScienceDirect | ||
|
Summary: to trigger the induction of ATP-Binding Cassette (ABC) transporters, responsible for the efflux of the drug... of CPT11-induced overexpression of ABC transporters. We then theoretically optimized exposure to CPT11... given as a single agent or combined either with ABC ... |
|||
|
Source: Clairambault, Jean - Biologie, Analyse Numérique, Géophysique Team, INRIA Paris-Rocquencourt |
|||
|
Collection: Biology and Medicine |
|||
| 26 | Chemistry and Physics of Lipids 141 (2006) 119132 Proteins involved in lipid translocation in eukaryotic cells | ||
|
Summary: in inwards lipid transport from the exoplasmic leaflet to the cytosolic leaflet and ABC proteins involved... ) Proteoliposomes Pdr5p, Yor1p PE Decottignies et al. (1998) Yeast ABCB4 (mdr2/MDR3) PC Yes Ruetz and Gros (1994... the capacity of ABC proteins to transport ... |
|||
|
Source: Institut de Biologie Physico-Chimique CNRS, Physico-Chimie Moléculaire des Membranes Biologiques |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 27 | UNIVERSITE JOSEPH FOURIER -GRENOBLE I ECOLE DOCTORALE CHIMIE ET SCIENCES DU VIVANT | ||
|
Summary: Characterization of 2 bacterial ABC ("ATP-Binding Cassette") transporters of unknown function : YheI/YheH from... belong to the large superfamily of ABC ("ATP-binding cassette") transporters. These proteins couple ATP... in antibiotic resistance. Two new bacterial ABC ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 28 | ATP-binding cassette protein E is involved in gene transcription and translation in Caenorhabditis elegans | ||
|
Summary: and nucleus, and possibly as a nucleocytoplasmic transporter. In addition, RNAi data suggest that ABCE and NHR... Elsevier Inc. All rights reserved. Keywords: ABC transporter; ABCE; RNase L inhibitor; Caenorhabditis... of the largest protein families in both prokaryotes and eukaryotes. ... |
|||
|
Source: Baillie, David - Department of Molecular Biology and Biochemistry, Simon Fraser University |
|||
|
Collection: Biology and Medicine |
|||
| 29 | 2000 Macmillan Magazines Ltd NATURE CELL BIOLOGY | VOL 2 | JULY 2000 | www.nature.com/ncb 399 | ||
|
Summary: -binding-cassette transporter 1 (ABC1) has been implicated in processes related to membrane-lipid turnover. Here, using in vivo... -AI. The involvement of ABC1 in Tangier disease implies that the transporter modulates specific removal of cellular... of cytosolic calcium may be associ- ated with ... |
|||
|
Source: Institut de Biologie Physico-Chimique CNRS, Physico-Chimie Moléculaire des Membranes Biologiques |
|||
|
Collection: Chemistry ; Biology and Medicine |
|||
| 30 | Intragenic Suppressing Mutations Correct the Folding and Intracellular Traffic of Misfolded Mutants of Yor1p, a | ||
|
Summary: transporter (9) and on the yeast drug pump Pdr5 (10). However, despite the conserved nature of this interface... of Biological Sciences, Columbia University, New York, New York 10027 ATP-binding cassette (ABC) transporters... structural module. Given the conserved topology of many ... |
|||
|
Source: Miller, Liz - Department of Biological Sciences, Columbia University |
|||
|
Collection: Biology and Medicine |
|||
| 31 | ANNOUNCEMENT Project Atmospheric Brown Cloud (ABC) 2006 TRAINING SCHOOL | ||
|
Summary: ANNOUNCEMENT Project Atmospheric Brown Cloud (ABC) 2006 TRAINING SCHOOL Project ABC Science... in a special training school conducted by Project ABC during 4-14 December 2006 in Asia. · Lecturures... Course Director" at: For US students: <ABC_Training-School@fiji.ucsd.edu> For Asian students: ... |
|||
|
Source: Goldstein, Allen - Department of Environmental Science Policy and Management, University of California at Berkeley |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 32 | PROTEIN INTERACTIONS AND DISEASE PHENOTYPES IN THE ABC TRANSPORTER SUPERFAMILY | ||
|
Summary: PROTEIN INTERACTIONS AND DISEASE PHENOTYPES IN THE ABC TRANSPORTER SUPERFAMILY LIBUSHA KELLY1... Francisco, CA 94158, USA. ABC transporter proteins couple the energy of ATP binding and hydrolysis... known ABC transporters in diseases such as cystic fibrosis and ... |
|||
|
Source: Sali, Andrej - Department of Biochemistry and Biophysics, University of California at San Francisco |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 33 | Ribosome recycling depends on a mechanistic link between the FeS cluster domain and a | ||
|
Summary: , Lewinson O (2009) ABC transporters: The power to change. Nat Rev Mol Cell Biol 10:218227. 5. Schmitt L... , Tampé R (2002) Structure and mechanism of ABC transporters. Curr Opin Struct Biol 12:754760. 6. Hopfner... 25:98599873. 8. Hopfner KP, Tainer JA (2003) Rad50/SMC proteins and ... |
|||
|
Source: Bedwell, David M. - Department of Microbiology, University of Alabama at Birmingham |
|||
|
Collection: Biology and Medicine |
|||
| 34 | Invited Review Functional expression of heterologous proteins in yeast: insights | ||
|
Summary: , seven pleiotropic drug-resistant transporters, YOR1, SNQ2, PDR5, YCF1, PDR10, PDR11, and PDR15, together... (ADH1), and pleiotropic drug-resistant pump (PDR5). Of these, the PMA1 and PDR5 promoters are excep... . In the presence of the mutant ... |
|||
|
Source: Rao, Rajini - Department of Physiology, Johns Hopkins University |
|||
|
Collection: Biology and Medicine |
|||
| 35 | This journal is c The Royal Society of Chemistry 2011 Mol. BioSyst., 2011, 7, 533544 533 Cite this: Mol. BioSyst., 2011, 7, 533544 | ||
|
Summary: that exogenously added metabolites would have on statin-treated yeast, we used yeast bearing a PDR5 deletion. PDR5... 4741a, BY4742a and PDR5 knockout strains thereof were obtained from Open Biosystems (Huntsville, AL... and hybridization The yeast strain BY4741a ... |
|||
|
Source: Fields, Stan - Department of Genome Sciences, University of Washington at Seattle |
|||
|
Collection: Biology and Medicine |
|||
| 36 | The ABC of ABC-transport in the hyperthermophilic | ||
|
Summary: The ABC of ABC-transport in the hyperthermophilic archaeon Pyrococcus furiosus #12;This work... ;RIJKSUNIVERSITEIT GRONINGEN The ABC of ABC-transport in the hyperthermophilic archaeon Pyrococcus furiosus... by an inducible, high-affinity ABC-transporter 25 Chapter 3 Biochemical evidence ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 37 | Galapagos whales hold pollutant mystery > News in Science (ABC Science) http://www.abc.net.au/science/articles/2010/12/06/3085949.htm[12/6/2010 3:21:02 PM] | ||
|
Summary: Galapagos whales hold pollutant mystery > News in Science (ABC Science) http://www.abc... pollutant mystery Katherine Nightingale ABC Whales living near the Galapagos Islands appear to have been... , industry, agricultural practices - all of those contaminants end Browse the archiveSearch ABC Science Share |
|||
|
Source: Rock, Chris - Department of Biological Sciences, Texas Tech University |
|||
|
Collection: Biology and Medicine |
|||
| 38 | List of publications Jacobs, M. H., T. v.d. Heide, A. J. Driessen, and W. N. Konings. 1996. Glutamate transport in | ||
|
Summary: .Bacteriol. 182:203-206. Heide, T. v. d. and B. Poolman. 2000. Osmoregulated ABC transport system of Lactococcus... of an ABC transport system for glycine betaine. EMBO J. 20:7022-7032. Wood, J. M., E. Bremer, L. N. Csonka... and function of osmoregulated ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 39 | YEAST VOL. 13: 583589 (1997) Sequence Analysis of a 332 kb Segment from the Left | ||
|
Summary: and other transmembrane ABC transporters, another one has similarities to inositol phosphatases and others... ; HAL2; SCORFAC; white gene; ABC transporters; inositol phoshatases; membrane proteins; ATP/GTP- binding... of ABC transporters (Higgins, 1992). The highest ... |
|||
|
Source: Alexandraki, Despina - Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Hellas |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 40 | ABC transporters: 1, 2 or 4 substrate-binding Tiemen van der Heide and Bert Poolman | ||
|
Summary: Chapter 6 65 ABC transporters: 1, 2 or 4 substrate-binding domains? Tiemen van der Heide and Bert... Poolman Summary Two families of ATP-binding Cassette (ABC) transporters have been detected, in which one... transporter complex. The translocator of ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 41 | Current Biology, Vol. 15, 18991911, November 8, 2005, 2005 Elsevier Ltd All rights reserved. DOI 10.1016/j.cub.2005.09.052 Patterns of Auxin Transport and Gene Expression | ||
|
Summary: 10.1016/j.cub.2005.09.052 Patterns of Auxin Transport and Gene Expression during Primordium... , and the sites of floral meristem initiation. Conclusions: These results provide new insight into auxin transport... dynamics during primordial positioning and suggest a role for auxin transport in influencing pri- mordial |
|||
|
Source: Meyerowitz, Elliot M. - Division of Biology, California Institute of Technology |
|||
|
Collection: Biology and Medicine |
|||
| 42 | Summary and concluding remarks The archaeon Pyrococcus furiosus | ||
|
Summary: were studied during this thesis work. Three inducible ATP-binding cassette (ABC-) transport systems... source are all transported by one of these three ABC-transporters. Cellobiose/-Glucoside transport P... of the ABC-transport family (Chapter 2) and ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 43 | Direct and selective elimination of specific prions and amyloids by 4,5-dianilinophthalimide and analogs | ||
|
Summary: , we examined their [PSI ]-curing ability. We used a strain lacking the ABC transporter, Pdr5, which... pumps small molecules out of the cell. PDR5 cells stably propa- gated [PSI ] (Fig. 4C). DMSO ( 5%) cures... transformants was determined. Values are means SD (n 3). ... |
|||
|
Source: Lindquist, Susan - Whitehead Institute for Biomedical Research, Massachusetts Institute of Technology (MIT); Sharp, Kim - Department of Biochemistry and Biophysics, University of Pennsylvania; Shorter, James - Department of Biochemistry and Biophysics, University of Pennsylvania |
|||
|
Collection: Biology and Medicine ; Chemistry |
|||
| 44 | BioMed Central Page 1 of 21 | ||
|
Summary: to be altered in the wine yeast strains: an AYT1 deletion strain (ScAYT1; [75]), a PDR5 deletion strain (JG436... -strain differences appear to be in transporter genes, especially hexose transporters (HXT genes), metal ion sensors... / transporters (CUP1, ZRT1, ENA genes), members of the ... |
|||
|
Source: Sherlock, Gavin - Department of Genetics, Stanford University |
|||
|
Collection: Biology and Medicine |
|||
| 45 | 50years of service excellenceyears of service excellenceyears of service excellence 50years of service excellenceyears of service excellenceyears of service excellence | ||
|
Summary: : Christine LeBlanc, EH&S Date: May 7, 2010 Re: Off-Site Management of Asphalt, Brick & Concrete (ABC) Debris... ______________________________________________________________________________ This memorandum further clarifies the requirements for the off-site management of asphalt, brick and concrete (ABC... of Construction and Demolition ... |
|||
|
Source: Prentiss, Mara - Department of Physics, Harvard University |
|||
|
Collection: Physics |
|||
| 46 | Summary and concluding remarks Introduction | ||
|
Summary: (ABC) transporters MsbA, a lipid efflux system that was crystallized in three conformations... of a complete transporter is available yet, The abbreviations used are: ABC, ATP-binding cassette; ECD... by ABC transporters, in particular that of the oligopeptide ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 47 | Gene 221 (1998) 117125 Isolation of an Arabidopsis thaliana cDNA by complementation of a yeast | ||
|
Summary: Gene 221 (1998) 117125 Isolation of an Arabidopsis thaliana cDNA by complementation of a yeast abc... 1998; Received by B. Dujon Abstract The yeast Abc1 protein acts as a chaperone-like protein essential... complementation of a yeast abc1 mutant, we have identified an Arabidopsis thaliana cDNA that corresponds |
|||
|
Source: Hamel, Patrice - Department of Plant Cellular and Molecular Biology, Ohio State University; Meier, Iris - Department of Plant Cellular and Molecular Biology, Ohio State University |
|||
|
Collection: Biology and Medicine |
|||
| 48 | Abstract. The typically distinct phospholipid composi-tion of the two leaflets of a membrane bilayer is generated | ||
|
Summary: assembly, membrane asymmetry, lipid flip-flop, N-glycosylation, ABC transporter, P-type ATPase, scramblase... about as a result of the action of energy-dependent flippases (P-type ATPases and ABC transporters; see... members) or away from the cytosolic leaflet (ABC ... |
|||
|
Source: Menon, Anant K. - Menon Lab, Weill Medical College, Cornell University |
|||
|
Collection: Biology and Medicine |
|||
| 49 | Single-RNA counting reveals alternative modes of gene expression in yeast | ||
|
Summary: that are clearly separated in time, rather than by transcriptional bursts. In contrast, PDR5, a gene regulated... 30 40 50 0.00 0.02 0.04 0.06 0.08 0.10 0.12 PDR5 n = 13.4 Nascent mRNAs 4,436 PDR5 0.0 0.1 0.2 0.3 0... 2 4 6 8 10 Frequency POL1 n = 3.1 0 5 10 15 20 ... |
|||
|
Source: Singer, Robert H. - Department of Anatomy and Structural Biology, Albert Einstein College of Medicine, Yeshiva University |
|||
|
Collection: Biology and Medicine |
|||
| 50 | Asynchronous Bit-stream Compression (ABC) Arkadiy Morgenshtein, Avinoam Kolodny, Ran Ginosar | ||
|
Summary: and after the transportation along the link. In this section we describe the architecture of the ABC... Asynchronous Bit-stream Compression (ABC) Arkadiy Morgenshtein, Avinoam Kolodny, Ran Ginosar... propose a new technique of Asynchronous Bit-stream Compression (ABC), based on Level Encoded Dual- Rail |
|||
|
Source: Kolodny, Avinoam - Department of Electrical Engineering, Technion, Israel Institute of Technology |
|||
|
Collection: Engineering |
|||
| 51 | Copyright 2007 by the Genetics Society of America DOI: 10.1534/genetics.106.066720 | ||
|
Summary: Accepted for publication December 24, 2006 ABSTRACT ABC transporters constitute one of the largest gene... -binding cassette (ABC) transporter proteins con- stitute one of the largest protein families in both prokaryotes... acids into the cell. In eukaryotes, the majority of ABC ... |
|||
|
Source: Baillie, David - Department of Molecular Biology and Biochemistry, Simon Fraser University |
|||
|
Collection: Biology and Medicine |
|||
| 52 | Profiling of ABC transporters Justina Clarinda Wolters | ||
|
Summary: Profiling of ABC transporters Justina Clarinda Wolters #12... by the Netherlands Proteomics Centre (NPC). #12; RIJKSUNIVERSITEIT GRONINGEN Profiling of ABC... transporters Proefschrift ter verkrijging van het doctoraat in de Wiskunde en Natuurwetenschappen |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 53 | General Introduction Chapter 1: General Introduction | ||
|
Summary: -dependent primary transporters 21 4.1: The ABC superfamily portrait 21 4.2: The substrate-binding domain 22 4... -dependent transporters 27 5.1: Substrate binding 28 5.2: Functional interactions in the binding protein-dependent 30 ABC... -hydrolysis (Fig. 1c). These proteins are members of the ATP-binding ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 54 | List of publications 1. Poelarends, G.J., Mazurkiewicz, P., Putman, M., Cool, R.H., van Veen, | ||
|
Summary: .W., and Konings, W.N. (2000). An ABC-type multidrug transporter of Lactococcus lactis possesses an exceptionally... a heterodimeric ABC- type multidrug transporter. Accepted to J. Biol. Chem. 7. Mazurkiewicz, P., Driessen, A... in transport of lipophilic cationic compounds. J. Biol. ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 55 | Expression Analysis of ABC Transporters Reveals Differential Functions of Tandemly Duplicated Genes in | ||
|
Summary: Expression Analysis of ABC Transporters Reveals Differential Functions of Tandemly Duplicated Genes... , BC Canada V5Z 1L6 We have previously identified 60 predicted ABC transporter genes... region for a neighbouring gene. q 2004 Elsevier Ltd. All rights reserved. Keywords: ABC ... |
|||
|
Source: Baillie, David - Department of Molecular Biology and Biochemistry, Simon Fraser University |
|||
|
Collection: Biology and Medicine |
|||
| 56 | A genomic survey of the distribution of ABC-transporters in the hyperthermophilic archaeal Pyrococcus species | ||
|
Summary: Chapter 5 1 A genomic survey of the distribution of ABC-transporters in the hyperthermophilic... of ABC-transport systems. Of the seventeen to nineteen ABC-transporters present per species, eight... , phosphoenolpyruvate (PEP)- dependent phosphotransferase systems (PTS), and ATP-binding cassette (ABC-) ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 57 | Nederlandse samenvatting voor geinteresseerden buiten dit | ||
|
Summary: als transporteiwitten. Een speciale categorie membraaneiwitten zijn de ABC-transport eiwitten. ABC... membraan uit te voeren. ABC- transport eiwitten zijn te vinden in alle organismen, en hebben een belangri... stoffen. De ABC-transport eiwitten zijn normaal gesproken opgebouwd uit drie ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 58 | THIS DOCUMENT IS PROVIDED AS A GUIDE FOR CONSIDERING THE RANGE OF ISSUES RELATED TO DEVELOPING INTERNATIONAL PROGRAMS. ANSWERS | ||
|
Summary: be included? How many? o Is laundry service provided? Transportation o For what transportation costs will ABC... RELATED SERVICES Between Company/University ABC [City, Country] And California State University, Fullerton... , Fullerton ("University") and Company/University ABC ... |
|||
|
Source: de Lijser, Peter - Department of Chemistry and Biochemistry, California State University, Fullerton |
|||
|
Collection: Chemistry |
|||
| 59 | Discussion and concluding remarks General introduction | ||
|
Summary: activated transporters. A detailed study of the osmoregulated ATP- binding cassette (ABC) transporter Opu... into the mechanism rooting the osmotic activation of OpuA and to prove that this `two-component ABC transporter... in the membrane and/or the orientation after reconstitution is ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 60 | Crosstalk and differential response to abiotic and biotic stressors reflected at the transcriptional level of effector genes from secondary metabolismw | ||
|
Summary: -utilizing enzymes along with 62 cytochrome P450 monooxygenases and 26 ABC transporters. Their transcriptome... transferases (GST), and eventually compartmentation via ATP-binding-cassette transporters (ABC transporters... ). Eventually, ABC ... |
|||
|
Source: Mauch, Felix - Department of Biology - Plant Biology, Université de Fribourg Suisse |
|||
|
Collection: Biology and Medicine |
|||
| 61 | Farmer Brown is standing in the middle of his perfectly circular field feeling very content. It is midnight and there is no moon and unknown to the farmer, | ||
|
Summary: at midnight. As soon as there are martians at points A,B,C such that triangle ABC contains the center... of the field, Farmer Brown will be teleported to the waiting space-ship and transported off to spend the rest |
|||
|
Source: Carnegie Mellon University, School of Computer Science |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 62 | 5-4079-01-P1 RIGHT-OF-WAY COST ESTIMATING TOOL | ||
|
Summary: Acquisition Cost Estimating Planning Tool AUGUST 2006 Performing Organization: Center for Transportation... Organization: Texas Department of Transportation Research and Technology Implementation Office P.O. Box 5080... Austin, Texas 78763-5080 Performed in cooperation with the Texas Department of Transportation |
|||
|
Source: Texas at Austin, University of - Center for Transportation Research |
|||
|
Collection: Energy Storage, Conversion and Utilization |
|||
| 63 | NAROM -Norwegian Centre for Space-related Education Rev. 18.10.11 | ||
|
Summary: balloons and the radiation belts JR Conference room ABC Together with CaNoRock IV 1930 Transport back... room ABC 1400 - 1415 Transport to ALOMAR AH ARR Transport 1415 - 1500 Presentation of ALOMAR Zuguang... Responsible Place Note 2300 Arrival Grønnbua/check in AH Grønnbua ... |
|||
|
Source: Johansen, Tom Henning - Department of Physics, Universitetet i Oslo |
|||
|
Collection: Materials Science |
|||
| 64 | Chapter 1 An introduction to adenine nucleotidebinding proteins Adenosine triphosphate | ||
|
Summary: binding cassette (ABC) transport ATPases has been the focus of this thesis and these proteins... through ligandgated ion channels [16]. Transport ATPases The P, V and FATPases together with the ABC... of an electrochemical ion gradient [19]. The class of ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 65 | List of publications List of publications | ||
|
Summary: , B. (2006) ABC transporter architecture and regulatory roles of accessory domains. FEBS Letters 580... -reconstituted ABC transporters. Methods Enzymol. 400, 429-459. Doeven, M. K., Kok, J., and Poolman, B. (2005... ) Specificity and selectivity of peptide transport in Lactococcus lactis ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 66 | Thermophilic P-loop transport ATPases: Enzyme function and energetics at high temperature | ||
|
Summary: Thermodynamics of the ATP hydrolysis cycle of GlcV, the Nucleotide Binding Domain of the Glucose ABC transporter... of the Glucose ABC Transporter of Sulfolobus solfataricus 65 Chapter 5 Summary and concluding remarks 81 Chapter... Thermophilic P-loop transport ATPases: Enzyme function ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 67 | Sugar Transport in (Hyper-)Thermophilic Archaea Sonja M. Koning, Sonja-Verena Albers, Wil N. Konings and Arnold J. M. | ||
|
Summary: at the expense of PEP; and iii) ATP binding cassette (ABC) transport, where the substrate is first bound... . Schematic overview of the different transport classes, namely secondary (A), PTS (B), and ABC (C). #12... ;Introduction 4 2.2. Binding protein dependent ABC- type ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 68 | General introduction I. General features of cell volume control | ||
|
Summary: to an osmotic upshift are substrate-binding protein-dependent ABC transporters, which use ATP as source... of the system for another transport cycle. The osmoregulated ABC transporters belong to the OTCN family (26... biochemical evidence is not available, the osmoregulated ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 69 | Summary and concluding ESEARCH on the structure and function of substrate-binding proteins (SBPs) | ||
|
Summary: -binding proteins (SBPs) of ATP Binding Cassette (ABC) transporters has been ongoing for at least four decades. Our... on the lactococcal oligopeptide binding protein A (OppA), the receptor component of the ABC-transporter oligopeptide... cycle of ABC-transporters. In recent years, the field has taken several ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 70 | Optical rectification and shift currents in GaAs and GaP response: Below and above the band gap | ||
|
Summary: , 2 abc - ; , where 0, within the independent particle approximation for the electron dynamics... . Particularly interesting is the limit 2 abc 0; ,- . In addition to the usual near-dc interband rectification... current, shift and injection currents, associated with actual divergences in 2 abc 0; ,- , are taken |
|||
|
Source: Sipe,J. E. - Department of Physics, University of Toronto |
|||
|
Collection: Physics |
|||
| 71 | "Extreme Project Management" One World Trade | ||
|
Summary: and construction of a variety of commercial, institutional and transportation facilities across the country... . Please check the links below for recent interviews of Ms. Tollner: Interview on ABC http://www.abc2news.com/dpp/news/national/abc |
|||
|
Source: Guiltinan, Mark - Department of Horticulture, Pennsylvania State University |
|||
|
Collection: Biotechnology |
|||
| 72 | Specificity of the oligopeptide ABC transporter The binding specificity of OppA determines the | ||
|
Summary: Specificity of the oligopeptide ABC transporter 35 Chapter 3 The binding specificity of Opp... A determines the selectivity of the oligopeptide ABC transporter Mark K. Doeven, Rupert Abele, Robert Tampé... ATP- binding cassette (ABC) transporter with a remarkably wide ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 73 | Boolean games revisited: compact preference representation in games Elise Bonzon, bonzon@irit.fr | ||
|
Summary: is acyclic then G has one and only one SPNE. Let G = (A,V,,) with A = {1,2}, V = {a,b,c}, 1 = {a,c}, 2 = {b... }, 1 = a;(¬b,c) , 2 = (¬b,¬c);¬a . P1 Disc abc abc abc abc abc abc abc ... |
|||
|
Source: Bonzon, Elise - UFR de Mathématiques et Informatique, Université René Descartes |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 74 | behorende bij het proefschrift "Relationships between MDR proteins, bacteriocin production and proteolysis in | ||
|
Summary: production and proteolysis in Lactococcus lactis" Olivera Gajic 1. The "flip-flop" model for ABC transporters... not hold truth for all members of the MDR-ABC transporter family. (Chang and Roth [2001] Science 293: 1793... , that was proposed by Chang and Roth on basis of the x-ray structure of the E. coli ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 75 | List of publications Harms, N., Ras, J., Koning, S., Reijnders, W. N. M., Stouthamer, A. H., van Spanning, R. | ||
|
Summary: in the hyperthermophilic archaeon Pyrococcus furiosus is mediated by an inducible, high-affinity ABC transporter. J... , A. J. M. (2002) Biochemical evidence for the presence of two -glucoside ABC-transport systems... transport in (hyper)thermophilic archaea. Res. Microbiol. 153:61-67. Koning, S. M., Konings, ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 76 | News in Science -Ancient bacteria take a breath -07/02/2000 http://www.abc.net.au/cgi-bin/common/printfriendly.pl?/science/news/st... 1 of 2 3/5/2008 12:55 PM | ||
|
Summary: News in Science - Ancient bacteria take a breath - 07/02/2000 http://www.abc.net... in Science - Ancient bacteria take a breath - 07/02/2000 [This is the print version of story http://www.abc... relative hemoglobin (the main protein in the red blood cell) play an essential role in oxygen transport |
|||
|
Source: Alam, Maqsudul - Department of Microbiology, University of Hawai'i at Manoa |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 77 | Molecular Cell Misfolded Membrane Proteins Are Specifically | ||
|
Summary: such as Hmg2p or Pdr5* (Hampton et al., 1996; Knop et al., 1996; Plemper et al., 1998). Substrates are diverse... degradation but is dispensible for integral membrane substrates such as Hmg2p or Pdr5* (Plemper et al., 1998... other ERAD-M substrates, 6myc-Hmg2p-GFP and ... |
|||
|
Source: Hampton, Randy - Division of Biological Sciences, University of California at San Diego |
|||
|
Collection: Biology and Medicine |
|||
| 78 | Glycine betaine transport by the ABC transporter OpuA is unidirectional and tightly coupled to ATP- | ||
|
Summary: Chapter 5 57 Glycine betaine transport by the ABC transporter OpuA is unidirectional and tightly... the osmotic-upshift activated ABC transporter OpuA from Lactococcus lactis is unidirectional and strictly... coupled to ATP-hydrolysis, with a stoichiometry of 2 to 4. Introduction In ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 79 | Biochemical Society Transactions (2002) Volume 30, part 4 1 Welch, R. M. (1995) Crit. Rev. Plant Sci. 14, 4982 | ||
|
Summary: determined that Mn transport by MntABC can be enhanced by Ca#+ [2]. We have also determined that Mn binding... as a repressor for the sca operon that encodes an Mn-permease similar to the MntABC transporter [12]. In E. coli... . and Guerinot, M. L. (2002) in Molecular and Cellular Iron ... |
|||
|
Source: Pakrasi, Himadri - Department of Biology, Washington University in St. Louis |
|||
|
Collection: Biology and Medicine |
|||
| 80 | Name: Foreign Lang. 2 yrs HS or 2 Sem Co Option: Spatial Science Computer Not Req | ||
|
Summary: STAT 302 or 211 (3-0) 3 ABC GEOG 203/213 or BIOL 112 (3-3) 4 ABC CHEM 102 (3-3) 4 ABC Science BOTN 101... or BIOL 111 (3-3) 4 ABC CHEM 101 (3-3) 4 ABC English ENGL 104 (Taken before U3) (3-0) 3 ABC ENGL 210... or ENGL 301 or AGJR 404 (3-0) 3 ABC ... |
|||
|
Source: Texas A&M University, Spatial Sciences Laboratory |
|||
|
Collection: Geosciences |
|||
| 81 | Gulf of Alaska groundfish assessments Report of the | ||
|
Summary: shelf transport. Conditions east of the Alaska Peninsula were less stormy with more transport through... species" ABC and OFL recommended Aggregate sum of component groups Economic overview (2007-08 fishery... of Alaska groundfish assessments GOA Catch and ABC levels - 50,000 100,000 150,000 200,000 250,000 ... |
|||
|
Source: NOAA Marine Fisheries Review |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 82 | ARA9 Modifies Agonist Signaling through an Increase in Cytosolic Aryl Hydrocarbon Receptor* | ||
|
Summary: by the specific binding at time 0 (B0) versus time in minutes. RESULTS Given the role that the transporter, Pdr5p... transporter, such as Pdr5p (Ref. 29; Fig. 1). Thus, it is plausible that FK506 was influencing cellular pumps... pathways, we first set out to ... |
|||
|
Source: Bradfield, Christopher A. - McArdle Laboratory for Cancer , University of Wisconsin at Madison; Last, Robert L. - Department of Biochemistry and Molecular Biology, Michigan State University |
|||
|
Collection: Biology and Medicine |
|||
| 83 | Bock et al. 2006 Family Summary 1.A.1 Voltage-gated Ion ChannVIC 36 34 2 | ||
|
Summary: homolog, ABC transporter WBC 26 26 982 3.A.1.205 Pleiotropic Drug ResistancABC 143 pleiotropic drug... resistance ABC transporter PDR 15 11 1008 3.A.1.205 Pleiotropic Drug ResistancABC 157 putative white... -brown complex homolog, ABC ... |
|||
|
Source: Sze, Heven - Department of Cell Biology and Molecular Genetics, University of Maryland at College Park |
|||
|
Collection: Biology and Medicine |
|||
| 84 | The EMBO Journal Vol.16 No.7 pp.17101720, 1997 Regulation of yAP-1 nuclear localization in response | ||
|
Summary: ), and(Welch, 1993; Mager and Kruijff, 1995; Ruis and Shu¨ller, the additional ABC transporter proteins... PDR5 and SNQ21995). Such responses are important for cell survival and (Miyahara et al., 1996).as... resulted in re-localization of wild-type protein to et al., 1995), ... |
|||
|
Source: Lycan, Deborah E. - Department of Biology, Lewis and Clark College |
|||
|
Collection: Biology and Medicine |
|||
| 85 | Mechanism of Antifungal Activity of Terpenoid Phenols Resembles Calcium Stress3 and Inhibition of the TOR Pathway4 | ||
|
Summary: , including many23 #12;14 members of the ABC drug transporter family such as SNQ2, YOR1, PDR5, PDR10 and1 PDR... values of <0.0005.6 UP REGULATED Drug/ABC Transporters SNQ2, PDR15, YOR1, VMR1, PDR11, PXA2, STE6, PDR18... , ... |
|||
|
Source: Rao, Rajini - Department of Physiology, Johns Hopkins University |
|||
|
Collection: Biology and Medicine |
|||
| 86 | An easy way of transcribing folk and traditional music Version 1.6.1 January '97 | ||
|
Summary: ABC2MTEX An easy way of transcribing folk and traditional music Version 1.6.1 January '97 Chris... Introduction 1 1.1 Other abc packages... : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1 1.2 The ABC2MTEX mailing list |
|||
|
Source: Read, Charles - School of Mathematics, University of Leeds |
|||
|
Collection: Mathematics |
|||
| 87 | Chapter 6 Summary and perspectives Profiling of adenine nucleotidebinding proteins with a focus on ABC transporters | ||
|
Summary: with a focus on ABC transporters Chapter 1 describes the structural fold of adenine nucleotidebinding... transporter OpuA The ABC transporter OpuA, used in this proteomics study (Chapter 5) as an example... and ionic strength dependence of the osmoregulatory ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 88 | Actor-networks and the diffusion of management accounting innovations: A comparative study | ||
|
Summary: -Based Costing (ABC). We are particularly concerned with the dynamic of actor-networks throughout the diffusion... -Network Theory; Diffusion; Translation; ABC; GP method. 1 Corresponding author. EM Lyon Business School, Dpt... ) and Activity-Based Costing (ABC) in France provide two illustrative stories for comparison. The ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 89 | The Seventh Cell of a Six-Cell Battery Delyan Raychev, Youhuizi Li and Weisong Shi | ||
|
Summary: propose an alternate method, called autonomous battery clusters (ABC), of building batteries and new ways... , the larger the cell-size will be, which inevitably brings higher overall transportation cost. Therefore... Battery Cluster (ABC) system, which could control cell groups and increase battery working time without |
|||
|
Source: Shi, Weisong - Department of Computer Science, Wayne State University |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 90 | DEVELOPMENT 3539RESEARCH ARTICLE | ||
|
Summary: ). For example, early patterning during embryogenesis is recognizable by expression of the auxin transporter, PIN... and the auxin transport inhibitor NPA. 2,4-D is an auxin analog that is poorly transported by the auxin efflux... to be downregulated in mutants defective in auxin transport (PIN1) and ... |
|||
|
Source: Meyerowitz, Elliot M. - Division of Biology, California Institute of Technology |
|||
|
Collection: Biology and Medicine |
|||
| 91 | Abbreviations A adenine | ||
|
Summary: 121 Abbreviations A adenine ABC (transporter) ATP-binding cassette (transporter) bp base pair |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 92 | Additional Table 3. COGs Analyzed and their Descriptions COG Protein Name | ||
|
Summary: protein A COG0753 Catalase COG0755 ABC-type transport system involved in cytochrome c biogenesis, permease... -3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase COG1137 ABC-type (unclassified) transport... system, ATPase component COG1175 ABC-type sugar transport ... |
|||
|
Source: Gerstein, Mark - Department of Molecular Biophysics and Biochemistry, Yale University |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 93 | Summary and concluding remarks Joanna M. Lubelska, Sonja-V. Albers and Arnold J.M. Driessen | ||
|
Summary: of sugars is coupled to proton and Na+ ions; and (3) ABC transport, in which uptake of sugars is coupled... for an involvement in the uptake of anorganic substrates (Koning et al., 2002). ABC transporters are widely... 2 we have examined the expression patterns of the glucose and arabinose ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 94 | Introduction General introduction | ||
|
Summary: others including ATPases of the ABC transporter superfamily, the F-ATPase superfamily or the motor... characteristics. We are going to focus on the group of thermophilic RecA-like transport ATPases including ABC... ; amongst others including ATPases of the ABC ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 95 | General Introduction General Introduction | ||
|
Summary: superfamily of primary transporters are the ATP-binding cassette (ABC) transporters (Fig. 1; Higgins, 1992... . The oligopeptide ABC transporter ABC transporters are composed of two transmembrane domains (TMDs) plus two... ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 96 | Catalytic cycle of the oligopeptide ABC transporter Probing the catalytic cycle of the oligopeptide ABC | ||
|
Summary: Catalytic cycle of the oligopeptide ABC transporter 101 Chapter 7 Probing the catalytic cycle... of the oligopeptide ABC transporter by fluorescence correlation spectroscopy Mark K. Doeven, Geert van den Bogaart... for another catalytic cycle. Implications in terms of a general transport ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 97 | Cell, Vol. 93, 951960, June 12, 1998, Copyright 1998 by Cell Press The C. elegans Cell Corpse | ||
|
Summary: Engulfment Gene ced-7 Encodes a Protein Similar to ABC Transporters In the nematode Caenorhabditis elegans... protein has sequence similarity to and are readily distinguishable using Nomarski opticsABC transporters... . Like CED-7, the mammalian ABC transporter show ... |
|||
|
Source: Horvitz, H. Robert - Department of Biology, Massachusetts Institute of Technology (MIT) |
|||
|
Collection: Biology and Medicine |
|||
| 98 | On the osmotic signal and osmosensing mechanism of an | ||
|
Summary: On the osmotic signal and osmosensing mechanism of an ABC transport system #12;2 Voor mijn ouders... Cover: On the osmotic signal and osmosensing mechanism of an ABC transport system Cover design: Tiemen... signal and osmosensing mechanism of an ABC transport system ... |
|||
|
Source: Groningen, Rijksuniversiteit - Centre for Ecological and Evolutionary Studies, Department of Marine Benthic Ecology and Evolution, |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 99 | Supplemental Materials for Single RNA counting reveals alternative modes of gene | ||
|
Summary: .81 0.70 0.12 0.14 2.90 POl1 2575 4.61 24.77 30.81 0.07 0.68 2.00 3.75 PDR5 3070 17.27 54.10 74.40 0... .14 POL1 0.06 0.08 0.32 4.42 24.25 PDR5 0.44 4.70 6.70 10.60 50.80 a (min-1 ) Figure 7 blue circles b (min... -1 ) c (min-1 ) X2 m X2 N MDN1 0.30 2.28 1.30 16.13 6.28 POL1 0.07 0.68 2.00 21.04 9.50 ... |
|||
|
Source: Singer, Robert H. - Department of Anatomy and Structural Biology, Albert Einstein College of Medicine, Yeshiva University |
|||
|
Collection: Biology and Medicine |
|||
| 100 | JOURNAL OF BACTERIOLOGY, Jan. 2006, p. 464468 Vol. 188, No. 2 0021-9193/06/$08.00 0 doi:10.1128/JB.188.2.464468.2006 | ||
|
Summary: -nitrogenase activity when added to V-starved cells was about 3 10 9 M. The genes for an ABC-type vanadate transport... transport system that functioned in the vupB mutant. The vupABC genes belong to a family of putative metal... , and tungstate uptake is mediated by a specific ABC ... |
|||
|
Source: Thiel, Teresa - Department of Biology, University of Missouri-St. Louis |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||