Home

About

Advanced Search

Browse by Discipline

Scientific Societies

E-print Alerts

Add E-prints

E-print Network
FAQHELPSITE MAPCONTACT US


  Topic List  Advanced Search  
Sample search results for: a1d l-type ca

Page:   2  3  4  5 
 
1 channel b-subunits: structural insights AID our understanding
 

Summary:  .C. et al. (2001) Biophysical properties, pharmacology and modulation of human, neuronal L-type (a1D, Ca... GEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWITQAEELDME Jellyfish CaV1 382 GEFAKEKARQTKSGEFHKIREKHMLDDAVKGYLDWINQASDIENV vertebrate L-type consensus ...

  

Source: Dolphin, Annette C. - Department of Neuroscience, Physiology and Pharmacology, University College London

 

Collection: Biology and Medicine

 
2 Dendritic L-type calcium currents in mouse spinal motoneurons: implications for bistability
 

Summary:  Labs, Jerusalem) was used to label Class D L-type Ca2+ channels. Sections were incubated in anti-a1d... to both dihydropyridines and the L-channel activator FPL-64176. Furthermore, the a1D subunits of ...

  

Source: Manitoba, University of - Spinal Cord Research Centre

 

Collection: Biology and Medicine

 
3 Both N-and C-lobes of calmodulin are required for Ca2+ regulations of CaV1.2 Ca2+
 

Summary:  . Introduction Voltage-gated L-type Ca2+ channel has been suggested to be in- volved in many essential processes... of calmodulin tethering and Ca2+ -dependent inactivation of L-type Ca2+ channels, J. Biol. Chem. 276 (2001... reveals function and location of L-type ...

  

Source: Turner, Ray - Departments of Cell Biology & Anatomy, Physiology and Biophysics, University of Calgary

 

Collection: Biology and Medicine

 
4 Critical Dependence of cAMP Response Element-Binding Protein Phosphorylation on L-Type Calcium Channels Supports a Selective
 

Summary:  eleva- tions in intracellular Ca2 . Previous work has shown that Ca2 entry through L-type Ca2 channels... signaling occurs after activation of either L-type voltage-gated Ca2 chan- nels or NMDA receptors (NMDARs... dependent on the release of synaptic glutamate. ...

  

Source: Deisseroth, Karl - Departments of Psychiatry and Behavioral Sciences & Bioengineering, Stanford University

 

Collection: Biology and Medicine

 
5 Cellular/Molecular Facilitation of L-Type Ca2
 

Summary:  Cellular/Molecular Facilitation of L-Type Ca2 Channels in Dendritic Spines by Activation of 2... of Medicine, Houston, Texas 77030 We studied the contribution of L-type Ca2 channels to action potential... in these structures. The L-type Ca2 channel blockers nimodipine ...

  

Source: Saggau, Peter - Division of Neuroscience, Baylor College of Medicine

 

Collection: Biology and Medicine

 
6 Joseph L. Greenstein Raimond L. Winslow
 

Summary:  : 262 · Is there a change in the L-type Ca2+ Current? ICaL CACNA1C, CACNB1-4 ??? No Change Whole... of SR Ca2+ release and recently determined properties of L-Type Ca2+ channel inactivation. Common pool... by the ensemble behavior of independent CaRUs #12;The Cardiac ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
7 Cell Calcium 41 (2007) 123134 Structurefunction relationships of Ca spark activity in normal
 

Summary:  are SR Ca release events which occur rapidly follow- ing Ca influx via L-type Ca channels, and also... these images binary images were made (A3, B3 and D3, see text). Images A­C and A1­D1 are autoscaled. No 600 nm... , triggered by ...

  

Source: Kamp, Tim - Molecular and Cellular Pharmacology Training Program & Department of Physiology, University of Wisconsin at Madison

 

Collection: Biology and Medicine

 
8 Cell Calcium 46 (2009) 282292 Contents lists available at ScienceDirect
 

Summary:  the pharmacology of CaV1.3 L-type channels Arturo Andradea,1 , Alejandro Sandovalb,c , Ricardo González... V 2 subunit L-type calcium channels Gabapentin a b s t r a c t The auxiliary CaV 2 -1 subunit... . This is particularly important in the case of the neuronal L-type ...

  

Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa

 

Collection: Biology and Medicine

 
9 Calmodulin priming: Nuclear translocation of a calmodulin complex and the memory of prior
 

Summary:  responsive to Ca2 entry through L-type channels and promotes activation of the transcription factor CREB (c... , more sensitive to Ca2 elevation, and less specifically dependent on Ca2 influx through L-type channels... is initiated in hippocam- pal pyramidal cells by ...

  

Source: Deisseroth, Karl - Departments of Psychiatry and Behavioral Sciences & Bioengineering, Stanford University

 

Collection: Biology and Medicine

 
10 Nature Macmillan Publishers Ltd 1998 Translocation of calmodulin
 

Summary:  for the rapid phosphorylation of CREB. Certain Ca2+ entry systems (L-type Ca2+ channels and NMDA receptors... of CaM to the nucleus (Fig. 2a, b), which was sharply diminished by the L-type Ca2+ -channel antagonist... , and less than that of N-type channels at the time ...

  

Source: Deisseroth, Karl - Departments of Psychiatry and Behavioral Sciences & Bioengineering, Stanford University

 

Collection: Biology and Medicine

 
11 Numerical analysis of Ca2+ signaling in rat ventricular
 

Summary:  from the extracellular space by activating sarcolemmal Ca2+ channels (L-type Ca2+ channels, LCC... in the distribution of Ca2+ -transporting protein complexes (L-type Ca2+ channel, Na+ /Ca2+ exchanger) along the cell... membrane probably exist ...

  

Source: Holst, Michael J. - Department of Mathematics, University of California at San Diego

 

Collection: Mathematics

 
12 1999 Macmillan Magazines Ltd letters to nature
 

Summary:  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . L-type Ca2+ channels support Ca2+ entry into cells, which triggers cardiac contraction1 , ...

  

Source: Deisseroth, Karl - Departments of Psychiatry and Behavioral Sciences & Bioengineering, Stanford University

 

Collection: Biology and Medicine

 
13 "Relating Microscopic Properties of Calcium-Induced Calcium Release to Macroscopic
 

Summary:  of CICR? #12;Activation and Inactivation Mechanisms of the Cardiac L- Type Ca2+ Current Ca2+-Dependent... Local control models - Stern, MD (1992). Biophys. J. 63: 497-517 ~50,000 active L-Type Ca2+ channels... , simulate stochastic gating of ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
14 ISSN: 1524-4571 Copyright 2010 American Heart Association. All rights reserved. Print ISSN: 0009-7330. Online
 

Summary:  Syndrome Channels During Hypertension and2+Increased Coupled Gating of L-Type Ca http... 12, 2010circres.ahajournals.orgDownloaded from #12;Increased Coupled Gating of L-Type Ca2 Channels... , Jeffery D. Molkentin, John D. Scott, Luis F. Santana Rationale: L-Type (Cav1.2) ...

  

Source: Scott, John D. - Department of Pharmacology, University of Washington at Seattle

 

Collection: Biology and Medicine

 
15 An Integrative Model of the Cardiac Ventricular Myocyte Incorporating Local-Control of JSR Ca2+
 

Summary:  experimentally Yes, and the reason has to do with newly discovered properties of the L- Type Ca2+ channel #12... Mechanisms of the Cardiac L-Type Ca2+ Current , ( ) ( )[ ( ) ] ( ) ( ) [ ( ), ( )] Ca L Ca open CaI t G P t v... ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
16 John D. Scott and Luis F. Santana Manuel F. Navedo, Edward P. Cheng, Can Yuan, Scott Votaw, Jeffery D. Molkentin,
 

Summary:  on October 31, 2011http://circres.ahajournals.org/Downloaded from #12;Increased Coupled Gating of L-Type Ca2... , Jeffery D. Molkentin, John D. Scott, Luis F. Santana Rationale: L-Type (Cav1.2) Ca2 channels are critical... to illustrate a significant difference between groups. Results Optical Recordings of ...

  

Source: Scott, John D. - Department of Pharmacology, University of Washington at Seattle

 

Collection: Biology and Medicine

 
17 Biophysical Properties, Pharmacology, and Modulation of Human, Neuronal L-Type ( 1D, CaV1.3) Voltage-Dependent Calcium Currents
 

Summary:  Biophysical Properties, Pharmacology, and Modulation of Human, Neuronal L-Type ( 1D, CaV1... , neuronal L-type ( 1D, CaV1.3) voltage-dependent calcium currents. J Neurophysiol 85: 816­827, 2001. Voltage... (transiently expressed rD2R) modulation of 1D currents: whole cell recordings. A: ...

  

Source: Dolphin, Annette C. - Department of Neuroscience, Physiology and Pharmacology, University College London

 

Collection: Biology and Medicine

 
18 Regulation of Action Potential Duration in a Ventricular Myocyte Model Incorporating Local-
 

Summary:  ) in Ventricular Myocyte Models Models in which JSR Ca2+ release is a function of Ca2+ flux through L-Type Ca2... of CICR? #12;The Cardiac L-Type Ca2+ Current Activation and Inactivation Ca2+-Dependent Inactivation... each t, simulate stochastic ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
19 Multi-Scale Modeling in Rodent Ventricular Myocytes: Contributions of structural and functional heterogeneities to
 

Summary:  the sarcolemma contain specialized proteins [1], [4], [14]. The sarcolemmal L-type Ca2+ channels (LCC... (L-type Ca2+ channel, Na+ /Ca2+ exchanger, sarcolemmal Ca2+ ATPase) along the cell membrane probably... exist [10], [11], [15], [16]. The analysis suggests that ...

  

Source: Holst, Michael J. - Department of Mathematics, University of California at San Diego

 

Collection: Mathematics

 
20 Biochim Biophys Acta . Author manuscript Gene regulation by voltage-dependent calcium channels
 

Summary:  . It was therefore concluded that cytoplasmic Ca elevation driven by L-type calcium channels turns on a2+ calmodulin... -dependent gene regulation:2+ one indirectly mediated by Ca entry through L-type channels and another one... proteins2+ 2+ L-type calcium channels in hippocampal neurons ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics


Page:   2  3  4  5 
Page:   1  2  3  4  5 
 
21 Spontaneous Calcium Transients in Developing Cortical Neurons Regulate Axon Outgrowth
 

Summary:  . Louis, MO), the L-type VGCC antagonists nifedipine (Calbiochem, La Jolla, CA) and nimodipine (Calbiochem... to the 1C and 1D subunits of the L-type Ca2 channel (Calbiochem) were diluted 1:100 in blocking buffer... for 1 hr. In some experiments quantifying and comparing the expression of ...

  

Source: Kalil, Katherine - Department of Anatomy, University of Wisconsin at Madison

 

Collection: Biology and Medicine

 
22 Introduction Apis mellifera L. is native to Europe, Africa, and Asia (including Saudi
 

Summary:  samples, two mitotypes, A1 and A1d, accounted for 77% of the observed mitotypes, while mitotypes A1a, A26c... siete no se habían descrito anteriormente. De las 172 muestras, dos mitotipos, A1 y A1d, representaron... . State County Lat/Long Mitotype (n) Arkansas (2) ...

  

Source: Szalanski, Allen L. - Department of Entomology, University of Arkansas

 

Collection: Environmental Sciences and Ecology

 
23 Relating "Microscopic" Properties of Calcium-Induced Calcium Release to "Macroscopic" Function of the
 

Summary:  -517 #12;Issues Yes, and the reason has to do with newly discovered properties of the L- Type Ca2+ channel... and Inactivation Mechanisms of the Cardiac L-Type Ca2+ Current , ( ) ( )[ ( ) ] ( ) ( ) [ ( ), ( )] Ca L Ca open ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
24 Biophysical Journal Volume 71 December 1996 3064-3072 Analytical Steady-State Solution to the Rapid Buffering Approximation
 

Summary:  through clusters of L-type Ca2+ channels modulates growth cone behavior (Silver et al., 1990... of Ca2+- and Ba2+-mediated inactivation of L-type Ca2+ channels in embryonic chick ventricle cells... . DeFelice, and Y.-M. Liu. 1991. Gating of L-type ...

  

Source: Smith, Gregory Douglas - Department of Applied Science, College of William and Mary

 

Collection: Biology and Medicine

 
25 (166), pe4. [DOI: 10.1126/stke.2003.166.pe4]2003Sci. STKE Ricardo Dolmetsch (21 January 2003)
 

Summary:  of Ca2+ channel. One channel that has been implicated in signaling to the nu- cleus is the L-type... voltage-activated Ca2+ channel. Early studies found that Ca2+ influx through L-type channels... ). The effect of Ca influx through L-type channels ...

  

Source: Dolmetsch, Ricardo E. - Department of Neurobiology, Stanford University

 

Collection: Biology and Medicine

 
26 The Curious Case of a Wandering Kinase: CaMKII Spreads the Wealth?
 

Summary:  , translocation within areas not experiencing NMDAR activation was dependent upon a priming event mediated by L-type... MKII in response to L-type VGCC activity may preferentially release holoenzymes from F-actin, allowing... to recurrent network activity, leading to globally equivalent translocation as observed here. Activating ...

  

Source: Shen, Kang - Department of Biology, Stanford University

 

Collection: Biology and Medicine

 
27 Neuron, Vol. 25, 533535, March, 2000, Copyright 2000 by Cell Press Letter to the Editor
 

Summary:  will overlap at 1L, which may not mediate an L-type Ca2 current and Voltage-gated Ca2 channels mediate calcium... classes of Ca2 currents. L-type Ca2 cur- rents require a strong depolarization for activation, are long... lasting, and are blocked by the organic ...

  

Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa

 

Collection: Biology and Medicine

 
28 Ca2+-Induced Ca2+-Release in the Cardiac Myocyte: From Microscopic Channel Gating to Macroscopic Cell Behavior
 

Summary:  ) Nature 415: 198-205 10 nm T-Tubules & SR CICR ~50,000 active L-Type Ca2+ channels/cell (Rose et al, 1992... of CICR: Properties of the L-Type Ca2+ Channel (LCC) , ( ) ( )[ ( ) ] ( ) ( ) [ ( ), ( )] Ca L Ca open Ca... ;Incorporation of These ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
29 ION CHANNELS, RECEPTORS AND TRANSPORTERS Determinants of the voltage dependence of G protein
 

Summary:  , neuronal L-type (a1D, CaV1.3) voltage-dependent calcium currents. J Neurophysiol 85:816­828 4. Berrou L... , Kamp TJ (2005) Unique modulation of L-type Ca2+ channels by short auxiliary beta1d subunit present... GW, Nargeot J, Bourinet E (2002) ...

  

Source: Dolphin, Annette C. - Department of Neuroscience, Physiology and Pharmacology, University College London

 

Collection: Biology and Medicine

 
30 J Pharmacol Sci 112, 397 404 (2010) Journal of Pharmacological Sciences 2010 The Japanese Pharmacological Society
 

Summary:  Pharmacological Society Introduction The voltage-gated L-type Ca2+ channel is an essential part of the signal... Found for Medical Research. References 1 Zühlke RD, Reuter H. Ca2+ -sensitive inactivation of L-type Ca2... of calmodulin tethering and Ca2+ -dependent ...

  

Source: Turner, Ray - Departments of Cell Biology & Anatomy, Physiology and Biophysics, University of Calgary

 

Collection: Biology and Medicine

 
31 A role of the endoplasmic reticulum in a mathematical model of corticotroph action potentials
 

Summary:  intracellular mechanisms, modulates the voltage sensitivity of the L-type Ca2+ channels embedded in the plasma... that an increase in the L-type Ca2+ current is sufficient to generate repetitive action potentials [LeBeau et al... potentials are Ca2+ transients, predominately, if not ...

  

Source: Reale, Marco - Department of Mathematics and Statistics, University of Canterbury

 

Collection: Mathematics

 
32 96:235-251, 2006. First published Apr 26, 2006; doi:10.1152/jn.01094.2005J Neurophysiol Andrei I. Ivanov and Ronald L. Calabrese
 

Summary:  of the htIPSPs. A2­D2: plots of htIPSCs (P) (empty circles) and gIPSCs (black line), extracted from A1­D1... : graded, gated by Ca2 entering by low-threshold [low- voltage­activated (LVA)] Ca channels and spike... -mediated, gated by Ca2 entering by high-threshold ...

  

Source: Calabrese, Ronald - Department of Biology, Emory University

 

Collection: Biology and Medicine

 
33 Eurythermal animals maintain aerobic performance throughout a range of acute temperature fluctuations. Rainbow
 

Summary:  of the L-type Ca2+ channel current (ICa) at 7°C, 14°C and 21°C, providing additional evidence of maintained... in vivo. Key words: L-type Ca2+ current (ICa), ICa inactivation, sarcoplasmic reticulum, Ca2+ load... , and SR Ca2+ release, by examining the effect of SR ...

  

Source: Farrell, Anthony P. - Faculty of Land and Food Systems, University of British Columbia

 

Collection: Environmental Sciences and Ecology ; Biology and Medicine

 
34 Neural Networks 20 (2007) 653667 www.elsevier.com/locate/neunet
 

Summary:  in subregions A3­D3 of CA3, respectively, through mossy fibers, and to A1­D1 of CA1, respectively, through... perforant path fibers (Fig. 3(a)). Each subregion in CA3 (A3­D3) and CA1 ...

  

Source: Miller, Paul - Volen Center for Complex Systems, Brandeis University

 

Collection: Physics ; Materials Science

 
35 The feedback of a localized calcium domain on calcium-gated channels
 

Summary:  be redu- ced? · Applications to cardiac myocytes: coupling between L-type channels and RyR #12;Thank you... D. Smith Applied Science Department College of William and Mary #12;Ca2+ signalling in cells Ca 2... + Na + -exchanger/ Ca 2+ channel Ca 2+ pump Ca 2+ ...

  

Source: Mazzag, Borbala "Bori" - Department of Mathematics, Humboldt State University

 

Collection: Biology and Medicine ; Mathematics

 
36 Intracellular Ca2+ signalling influences a broad range of
 

Summary:  induced by netrin 1, as Ca2+ signals in response to netrin 1 were reduced, but not eliminated, when L-type... when L-type Ca2+ channels are blocked. However, some Ca2+ influx is still required for chemorepulsion... for repulsive turning when L-type channels are ...

  

Source: Kalil, Ronald E. - Neuroscience Training Program & W.M. Keck Laboratory for Biological Imaging, University of Wisconsin at Madison; Zheng, James Q.- Department of Cell Biology, Emory University

 

Collection: Biology and Medicine

 
37 Calcium Dynamics in Cortical Astrocytes and Arterioles During Neurovascular Coupling
 

Summary:  in cortical astrocytes (Figure 1C). The EFS-induced rise in astrocytic [Ca2 ]i involved L-type voltage... -dependent Ca2 channels and IP3Rs (Figure 2). The L-type Ca2 channel blocker nifedipine (15 mol/L) reduced... by inhibition of L-type Ca2 ...

  

Source: Newman, Eric A. - Department of Neuroscience, University of Minnesota

 

Collection: Biology and Medicine

 
38 210 nature neuroscience volume 5 no 3 march 2002 Calcium entry into cells through voltage-gated Ca2+ channels
 

Summary:  M-dependent inactivation of Cav1 (L-type) channels11­13. The IQ domain of 12.1 inter- acts with CaM in vitro and also... + sensor for Ca2+-dependent inactivation of L-type calcium channels. Neuron 22, 549­558 (1999). 13. Zühlke... and facilitation of L-type calcium channels. Nature 399, ...

  

Source: Palczewski, Krzysztof - Department of Pharmacology, Case Western Reserve University

 

Collection: Biology and Medicine

 
39 Cellular/Molecular Switching of Ca2
 

Summary:  .3 channels comprise a vital subdivision of L-type Ca2 channels: CaV1.3 channels mediate neurotransmitter... channels represent a functionally distinctive member of the L-type (CaV1) family of Ca2 channels. Although... Cellular/Molecular Switching of ...

  

Source: Blackshaw, Seth - Department of Neuroscience, Johns Hopkins University

 

Collection: Biology and Medicine

 
40 The inward rectifier in a model of corticotroph electrical activity
 

Summary:  , by way of complex intracellular mechanisms, modulates the voltage sensitivity of the L-type Ca2+ channels... , which indicated that an increase in the L-type Ca2+ current is sufficient to generate repetitive action... in corticotrophs have not been identified, however PKA is known to phosphorylate ...

  

Source: Reale, Marco - Department of Mathematics and Statistics, University of Canterbury

 

Collection: Mathematics


Page:   1  2  3  4  5 
Page:   1  2  3  4  5 
 
41 Multi-Scale Modeling of Cardiac Excitation-Contraction (EC) Coupling
 

Summary:  of the Heart Bers (2002) Nature 415: 198-205 10 nm T-Tubules & SR CICR ~50,000 active L-Type Ca2+ channels... Ca2+ Channels (LCCs) Ca2+-Dependent Inactivation (CDI) + Voltage-Dependent Inactivation (VDI) Ca2+L-Type... on L-Type ...

  

Source: Winslow, Raimond - Center for Cardiovascular Bioinformatics and Modeling & Department of Biomedical Engineering, Johns Hopkins University

 

Collection: Biology and Medicine

 
42 Moment Closure for Local Control Models of Calcium-Induced Calcium Release in Cardiac Myocytes
 

Summary:  release sites using Monte Carlo methods. In these approaches, one or more L-type Ca21 channels interact... . These are coupled to N Markov chains representing the stochastic gating of each CaRU that consists of one L-type Ca... con- taining multiple L-type ...

  

Source: Smith, Gregory Douglas - Department of Applied Science, College of William and Mary

 

Collection: Biology and Medicine

 
43 Connors, B.W., and Gutnick, M.J. (1990). Trends Neurosci. 13, 99104.
 

Summary:  .06.023 Pacemaking activity in adult substantia nigra (SN) dopamine neurons relies on L-type Ca2+ channels... with an in- creased expression of slowly inacti- vating somatodendritic L-type Ca2+ channels that drive... V). In support of these new observations, knockout mice that don't express the Cav1.3 a ...

  

Source: Sulzer, David - Departments of Neurology & Psychiatry, Columbia University

 

Collection: Biology and Medicine

 
44 Numerical Analysis of Ca2+ Signaling in Rat Ventricular
 

Summary:  from the extracellular space by activating sarcolemmal Ca2+ channels (L- type Ca2+ channels, LCC... complexes (L-type Ca2+ channel, Na+ /Ca2+ exchanger) along the cell membrane probably exist [2... ,10,12,15,35­43]. The analysis suggests that ...

  

Source: Holst, Michael J. - Department of Mathematics, University of California at San Diego

 

Collection: Mathematics

 
45 Many fish inhabit eurythermal environments and must therefore be able to cope with changes in environmental
 

Summary:  + enters the myocyte through the L-type Ca2+ channel (Vornanen, 1997, 1998; Hove-Madsen and Tort, 1998... % of the activator Ca2+; Vornanen, 1999). Mammalian studies indicate that the L-type Ca2+ channel is temperature... al., 1985; guinea pig). If the temperature-dependency of the ...

  

Source: Farrell, Anthony P. - Faculty of Land and Food Systems, University of British Columbia

 

Collection: Environmental Sciences and Ecology ; Biology and Medicine

 
46 Gene regulation by voltage-dependent calcium channels
 

Summary:  concluded that cytoplasmic Ca2+ elevation driven by L-type calcium channels turns on a calmodulin... regulation: one indirectly mediated by Ca2+ entry through L-type channels and another one directly induced... + -activated proteins. In 1993, it was shown that Ca2+ entry through ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics

 
47 Filtering of Calcium Transients by the Endoplasmic Reticulum in Pancreatic b-Cells
 

Summary:  21 . We are interested here only in the Ca21 handling, so ion channels other than the L-type channels... are synchronized. The basic two-compartment model is illustrated in Fig. 1 A. Calcium enters the cell through L-type... of intracellular Ca21 . Using mathematical modeling, we analyze the filtering ...

  

Source: Bertram, Richard - Institute of Molecular Biophysics & Department of Mathematics, Florida State University

 

Collection: Mathematics ; Biology and Medicine

 
48 A Probability Density Approach to Modeling Local Control of Calcium-Induced Calcium Release in Cardiac Myocytes
 

Summary:  influx via L-type Ca21 channels and Ca21 - induced Ca21 release mediated by clusters of ryanodine... - age known as an action potential (AP). Membrane depolari- zation during the AP causes L-type Ca21... (RyRs) that is triggered by entry of Ca21 ...

  

Source: Smith, Gregory Douglas - Department of Applied Science, College of William and Mary

 

Collection: Biology and Medicine

 
49 Revised version of J Gen Physiol: 200709771 MOLECULAR DETERMINANT FOR SPECIFIC Ca/Ba
 

Summary:  constant at 10 mM), L-type (CaV1.2), P/Q-type (CaV2.1), N-type (CaV2.2) but also R-type (CaV2.3) HVA Ca2... . Characterization of the high-affinity Ca2+ binding sites in the L-type Ca2+ channel pore in rat ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics

 
50 Fundamental Ca2 Signaling Mechanisms in Mouse Dendritic
 

Summary:  , Application of Bay K8644 (15 M), an L-type Ca2 channel agonist, induced a Ca2 rise in a voltage- clamped DC... but no accompanying inward current. B, Nifedipine (50 M), an L-type Ca2 channel antagonist, induced a similar response... suggest that DHPs mobilize Ca2 ...

  

Source: Clapham, David E. - Department of Neurobiology, Harvard University

 

Collection: Biology and Medicine

 
51 Cell, Vol. 108, 739742, March 22, 2002, Copyright 2002 by Cell Press MinireviewCalmodulin in Action: Diversity
 

Summary:  ., 2000). Moreover, a recent CDI (Ca2 -dependent inactivation) of P/Q- and L-type study on the CBP/p300-p... Maria et al., methods for 3D structure determination become more 2001). In the case of L-type channels, Ca2... based on these binding criteria does not always identify CaM-inter- ...

  

Source: Ikura, Mitsuhiko - Division of Molecular and Structural Biology, University of Toronto

 

Collection: Biotechnology ; Biology and Medicine

 
52 Comparative Biochemistry and Physiology Part A 132 (2002) 827846 1095-6433/02/$ -see front matter 2002 Published by Elsevier Science Inc.
 

Summary:  trout; Crucian carp; Temperature acclimation; Temperature; Sarcoplasmic reticulum; L-type Ca channel; Na... -peak, peak density of L-type Ca current; RyR, ryanodine receptors; INCX, Na ­Ca2q q 2q Ca exchange... from the situation in mammalian hearts. 5.1. ...

  

Source: Farrell, Anthony P. - Faculty of Land and Food Systems, University of British Columbia

 

Collection: Environmental Sciences and Ecology ; Biology and Medicine

 
53 In vivo expression of G-protein 12 dimer in adult mouse skeletal muscle alters L-type calcium current and excitation-contraction coupling
 

Summary:  of both L-type Ca2+ current density and of peak amplitude of the voltage-activated Ca2+ transient in G12... ). Furthermore, GTPS was also reported to increase DHPR-L-type Ca2+ current and intramembrane charge movement... (open circle). The L-type ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics

 
54 Neurocomputing 70 (2007) 16401644 Modeling stress-induced adaptations in Ca2+
 

Summary:  type of the L-type Ca2+ currents (the Ls type), and a suppression of Ca2+ extrusion mechanism... types of L-type Ca2+ current, one with normal activation kinetics (Ls) and one with additional prolonged... + currents, most likely the L-type Ca2+ ...

  

Source: Poirazi, Yiota - Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Hellas

 

Collection: Biology and Medicine

 
55 RAPID COMMUNICATION Contribution of Voltage-Gated Ca2/
 

Summary:  -term depression in the CA1 region in vitro. J. Neurophysiol. due to the activity of L-type VGCCs (Christie et al... of homosynaptic LTD to different VGCC block- the induction of homosynaptic LTD. In addition, the L-type volt- ers... and insensitive to L-type VGCC antagonistsfluid (ACSF), LTD is produced. ...

  

Source: Johnston, Daniel - Center for Learning and Memory & Section of Neurobiology, Division of Biological Sciences, University of Texas at Austin

 

Collection: Biology and Medicine

 
56 Structural Analysis of Mg2 Binding to CaBP1, a
 

Summary:  reticulum membrane (11, 12). CaBP1 also interacts with P/Q-type voltage-gated Ca2 channels (13), L-type... to regulate Ca2 -dependent voltage gating of L-type Ca2 channels in the retina (17). Thus, the CaBP proteins... . Differential Regulation of ...

  

Source: Ikura, Mitsuhiko - Division of Molecular and Structural Biology, University of Toronto; Palczewski, Krzysztof - Department of Pharmacology, Case Western Reserve University

 

Collection: Biology and Medicine ; Biotechnology

 
57 Functional Expression and Characterization of a Voltage-Gated
 

Summary:  .3 channel with the cardiac L-type channel CaV1.2a (or 1C-a) after expression together with 2 - and 3... to- gether, we describe a neuroendocrine L-type CaV1.3 calcium channel that is stimulated by Gi... neuroendocrine L-type calcium channel consisting of the ...

  

Source: Dolphin, Annette C. - Department of Neuroscience, Physiology and Pharmacology, University College London

 

Collection: Biology and Medicine

 
58 In hippocampal CA1 pyramidal cells and in cerebellar Purkinje cells, transient depolarization by brief trains of
 

Summary:  + is that DSI is more sensitive to Ca2+ entry through N- and L-type channels than P- or Q-type channels (Lenz et... . E. (1998). N- and L-type calcium channel involvement in depolarization-induced suppression... In hippocampal CA1 pyramidal cells and in cerebellar Purkinje cells, transient depolarization

  

Source: Zucker, Robert S. - Department of Molecular and Cell Biology, University of California at Berkeley

 

Collection: Biology and Medicine

 
59 Protein Kinase C Regulates a Vesicular Class of Calcium Channels in the Bag Cell Neurons of Aplysia
 

Summary:  -a1A and BC-a1D , were used at 5 mg/ml as described by White and Electrophysiology on juvenile bag... traces for each voltageraised) or FP-II (the glutathione-S-transferase fusion protein to which aBC-a1D... clusters of juvenile Aplysia strongly express the ...

  

Source: Nick, Teresa - Center for Neurobehavioral Development & Department of Neuroscience, University of Minnesota

 

Collection: Biology and Medicine

 
60 Deactivation of L-type Ca Current by Inhibition Controls LTP at Excitatory
 

Summary:  Neuron Article Deactivation of L-type Ca Current by Inhibition Controls LTP at Excitatory Synapses... hyperpolariza- tion, indicating that inhibition of firing decreases Ca influx through L-type Ca channels... a calcineurin priming signal combines with an a-CaMKII ...

  

Source: Raman, Indira M. - Department of Neurobiology and Physiology, Northwestern University

 

Collection: Biology and Medicine


Page:   1  2  3  4  5 
Page:   1  2  3  4  5 
 
61 Action Potential Morphology Influences Intracellular Calcium Handling Stability and the Occurrence of Alternans
 

Summary:  processes such as the passage of Ca21 through voltage- and Ca21 -sensitive L-type Ca21 channels (ICa) and Na... ). The model incorporates cytosolic, submembrane, junctional SR, and network SR Ca21 concentrations, L-type Ca... by jlaj,1: FIGURE 2 ...

  

Source: Christini, David - Department Physiology and Biophysics, Cornell University

 

Collection: Biology and Medicine

 
62 Localization of cardiac L-type Ca2 to a caveolar macromolecular signaling complex
 

Summary:  Localization of cardiac L-type Ca2 channels to a caveolar macromolecular signaling complex... April 28, 2005) L-type Ca2 channels play a critical role in regulating Ca2 -depen- dent signaling... of cardiac L-type Ca2 channels and their regulation ...

  

Source: Kamp, Tim - Molecular and Cellular Pharmacology Training Program & Department of Physiology, University of Wisconsin at Madison

 

Collection: Biology and Medicine

 
63 Version date: 24 September 2004 currents in cardiac myocytes
 

Summary:  ionic currents). Tsien's laboratory proposed renaming si current as L-type Ca2+ current, for "Long... Lasting" (Nowycky et al., 1985); indeed, L type Ca2+ current contrasted with another Ca2+ current present... -00141882,version1 #12;4 the L ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics

 
64 Pulsed Laser Imaging of Ca2 Influx in a Neuroendocrine Terminal
 

Summary:  that these currents include contributions from N-, Q-, and L-type Ca2 currents (Lemos and Nowycky, 1989; Fisher... -localization of L-type Ca2 channels and insulin-containing secre- tory granules and its significance... ) 502:351­363. Wang X, Treistman SN, Lemos JR (1993) Single channel recordings of Nt- and ...

  

Source: Fernandez, Julio M. - Department of Biological Sciences, Columbia University

 

Collection: Chemistry ; Biology and Medicine ; Engineering

 
65 Cellular/Molecular Interaction via a Key Tryptophan in the III Linker of
 

Summary:  , CaV1­CaV3 (for review, see Ertel et al., 2000). The CaV1 class, L-type channels and the CaV2 class... , non-L-type channels are both high-voltage-activated (HVA). These are heteromultimers com- posed... Kingdom, and 2School of Crystallography, Birkbeck College, ...

  

Source: Dolphin, Annette C. - Department of Neuroscience, Physiology and Pharmacology, University College London

 

Collection: Biology and Medicine

 
66 Cardiac contractility is profoundly influenced by temperature in all vertebrates. This is not surprising as the
 

Summary:  + influx via the L-type Ca2+ channel current (ICa) is strongly influenced by temperature, with a Q10... - clamped and loaded with Fura-2 to measure the L-type Ca2+ channel current (ICa) and [Ca2+]i during... in rainbow trout heart. Key words: L-type ...

  

Source: Farrell, Anthony P. - Faculty of Land and Food Systems, University of British Columbia

 

Collection: Environmental Sciences and Ecology ; Biology and Medicine

 
67 17 -ESTRADIOL INDUCED Ca2 INFLUX VIA L-TYPE CALCIUM
 

Summary:  17 -ESTRADIOL INDUCED Ca2 INFLUX VIA L-TYPE CALCIUM CHANNELS ACTIVATES THE SRC... ) within minutes of exposure which was blocked by an L-type Ca2 channel antagonist. Inhibition of L-type Ca... that E2-induced Ca2 influx via the ...

  

Source: Brinton, Roberta Diaz - Laboratory for Neuroscience Research & School of Pharmacy, University of Southern California

 

Collection: Biology and Medicine

 
68 Chronic Benzodiazepine Administration Potentiates High Voltage-Activated Calcium Currents
 

Summary:  pharmacologically confirmed as predominantly L-type Ca2 currents via inhibition with nimodipine (10 M), a selective... channels. Sys- temic preinjection of nimodipine (10 mg/kg), an L-type (L)- VGCC antagonist, prevented... .1124/jpet.108.144444. ABBREVIATIONS: HVA, high voltage-activated; DHP, dihydropyridine; L-VGCC, ...

  

Source: Brand, Paul H. - Department of Physiology and Pharmacology, University of Toledo

 

Collection: Biology and Medicine

 
69 Cell, Vot.80, 259-268, January27, 1995,Copyright 1995by Cell Press Calcium Signaling Review
 

Summary:  voltage- dependent L type Ca2÷channels and N-methyI-D-aspartic acid (NMDA) receptors initiates gene... E. Clapham Department of Pharmacology Mayo Foundation Rochester, Minnesota 55905 Ionized calcium (Ca... neurons. Unlike many other second-messenger mo!ecules, Ca2÷ is required for ...

  

Source: Clapham, David E. - Department of Neurobiology, Harvard University

 

Collection: Biology and Medicine

 
70 Nieves-Cintrn, John D. Scott and Luis F. Santana Edward P. Cheng, Can Yuan, Manuel F. Navedo, Rose E. Dixon, Madeline
 

Summary:  E. Dixon, Madeline Syndrome by Ablation of an Anchoring Protein Restoration of Normal L-Type Ca 2... Restoration of Normal L-Type Ca2 Channel Function During Timothy Syndrome by Ablation of an Anchoring Protein... F. Santana Rationale: L-type Ca2 ...

  

Source: Scott, John D. - Department of Pharmacology, University of Washington at Seattle

 

Collection: Biology and Medicine

 
71 Benzodiazepine-induced hippocampal CA1 neuron alph...[Behav Pharmacol. 2007] -PubMed Result Behav Pharmacol. 2007 Sep;18(5-6):447-60. Links
 

Summary:  injection of an L-type voltage-gated calcium channel antagonist, nimodipine (10 mg/ kg, intraperitoneally... Benzodiazepine-induced hippocampal CA1 neuron alph...[Behav Pharmacol. 2007] - PubMed Result Behav... Pharmacol. 2007 Sep;18(5-6):447-60. Links Benzodiazepine-induced hippocampal CA1 neuron alpha-amino- 3

  

Source: Brand, Paul H. - Department of Physiology and Pharmacology, University of Toledo

 

Collection: Biology and Medicine

 
72 Structural Insights into Ca2 -dependent Regulation of
 

Summary:  (13, 14). CaBP1 also regulates P/Q-type voltage-gated Ca2 channels (23), L-type channels (24... ), and the transient receptor potential channel, TRPC5 (25). CaBP4 regulates Ca2 -dependent inhibition of L-type... in the channel. For example, Ca2 ...

  

Source: Ikura, Mitsuhiko - Division of Molecular and Structural Biology, University of Toronto

 

Collection: Biotechnology ; Biology and Medicine

 
73 Structural Insights into Ca2 -dependent Regulation of
 

Summary:  (13, 14). CaBP1 also regulates P/Q-type voltage-gated Ca2 channels (23), L-type channels (24... ), and the transient receptor potential channel, TRPC5 (25). CaBP4 regulates Ca2 -dependent inhibition of L-type... in the channel. For example, Ca2 ...

  

Source: Palczewski, Krzysztof - Department of Pharmacology, Case Western Reserve University

 

Collection: Biology and Medicine

 
74 Neurocomputing 6566 (2005) 305314 Modelling reduced excitability in aged CA1
 

Summary:  rights reserved. Keywords: Calcium-dependent modulation; Aging; sAHP; L-type Ca2þ channels ARTICLE... potentials [19]. This increase is largely attributed to an enhanced activity of L-type Ca2þ channels (LTCs... mechanisms [20]. L-type Ca2þ channels display two ...

  

Source: Poirazi, Yiota - Institute of Molecular Biology and Biotechnology, Foundation of Research and Technology, Hellas

 

Collection: Biology and Medicine

 
75 R E V I E W 204 TINS Vol. 20, No. 5, 1997 Copyright 1997, Elsevier Science Ltd. All rights reserved. 0166 -2236/97/$17.00 S0166-2236(96)01015-6
 

Summary:  detail). In gen- eral, L-type currents are blocked by dihydropyridine antagonists, N-type by -conotoxin... TX GVIA can weakly and reversibly inhibit L-type currents expressed in Xenopus oocytes40 . At many... the last decade. At neuronal somata, presynaptic modulators inhibit Ca2+ channels and activate K+ channels

  

Source: Saggau, Peter - Division of Neuroscience, Baylor College of Medicine

 

Collection: Biology and Medicine

 
76 PAC1hop receptor activation facilitates catecholamine secretion selectively through 2-APB-sensitive Ca2+
 

Summary:  -modulated extracellular Ca2+ entry in PC12 cells could be partially blocked with nimodipine, an inhibitor of L-type VGCCs... -evoked Ca2+ influx occurs partially through dihydropyridine- sensitive, L-type VGCCs but is not a major... of PACAP-evoked Ca2+ influx by the general cation influx ...

  

Source: McMahon, Francis - Genetic Basis of Mood and Anxiety Disorders, National Institute of Mental Health

 

Collection: Biology and Medicine

 
77 Postnatal Development of Cholinergic Synapses on Mouse Spinal Motoneurons
 

Summary:  motoneurons after double labeling with antibodies to VAChT protein (A1­D1) and 12.2 (A2­D2) at various... and dendrites with age (A1­D1). 1 2.2-IR fine puncta scarcely present at P3 (A2) began to cluster at P11 (C2... motoneurons after double labeling with ...

  

Source: Brownstone, Rob - Department of Anatomy and Neurobiology, Dalhousie University

 

Collection: Biology and Medicine

 
78 L-Type Calcium Channels Are Required for One Form of Hippocampal Mossy Fiber LTP
 

Summary:  of LTP had no effect on the expression of investigating the role of L-type voltage-gated Ca2/ channels... , obviating the possi- The highest density of L-type Ca2/ channels on CA3 bility that the presumed mossy fiber... channels into CA3 neurons. between the ...

  

Source: Johnston, Daniel - Center for Learning and Memory & Section of Neurobiology, Division of Biological Sciences, University of Texas at Austin

 

Collection: Biology and Medicine

 
79 Signaling to the Nucleus by an L-type Calcium Channel
 

Summary:  pathways are activated and thus specifies the cellular response to Ca2 . Ca2 influx through L-type voltage... for different functions (2). Acti- vation of the L-type Ca2 channel (LTC) specifically increases the expression... of CaM binding to the LTC for conveying ...

  

Source: Dolmetsch, Ricardo E. - Department of Neurobiology, Stanford University

 

Collection: Biology and Medicine

 
80 Investigation of Age-Related Cognitive Decline Using Mice as a Model System
 

Summary:  was not the result of an age-related increase in phosphorylation of the L-type channel CaV1.2 by cAMP- dependent... is calcium entering through L-type voltage-dependent calcium channels (L-VDCCs). The difference in [Ca2 ]i... ,21 and the Morris water maze.22 Furthermore, pharmacologic agents such as nimo- ...

  

Source: Silva, Alcino - Department of Neurobiology, University of California at Los Angeles

 

Collection: Biology and Medicine


Page:   1  2  3  4  5 
Page:   1  2  3  4  5 
 
81 proteinsSTRUCTURE O FUNCTION O BIOINFORMATICS Thermodynamics of calmodulin binding to
 

Summary:  is the dominant isoform in cardiac muscle. A muscle action potential initiates L-type Ca21 channel protein... and cardiac muscle, the release of Ca21 ions through ryanodine receptor calcium release channels (Ry... conformational changes that either permit an influx of extracellular Ca21 (in cardiac muscle)1 ...

  

Source: Dokholyan, Nikolay V. - Department of Biochemistry and Biophysics, University of North Carolina at Chapel Hill

 

Collection: Physics ; Biology and Medicine

 
82 691 J. Gen. Physiol. The Rockefeller University Press 0022-1295/2000/11/691/5 $5.00 Volume 116 November 2000 691695
 

Summary:  receptors and L-type calcium channels in neurons. Nature. 382:719­722. Cohen, A.S., K.A. Moore, R. Bangalore... in Ca2 Signaling over Different Time and Distance Scales Jonathan S. Marchant and Ian Parker From... of California, Ir- vine, Irvine, California 92697 Cytosolic Ca2 plays a central role in the regulation

  

Source: Marchant, Jonathan - Deptartment of Pharmacology, University of Minnesota; Parker, Ian - Department of Neurobiology and Behavior, University of California, Irvine

 

Collection: Biology and Medicine

 
83 Protein Geometry and Placement in the Cardiac Dyad Influence Macroscopic Properties of Calcium-Induced Calcium Release
 

Summary:  of stochastic molecular signaling between L-type Ca21 channels (LCCs) and ryanodine receptors (RyR2s... when individual L-type calcium (Ca21 ) channels (LCCs) open in response to membrane depolarization, pro... -induced calcium release in the dyad. Ca21 ions pass through ...

  

Source: Sun, Sean - Department of Mechanical Engineering, Johns Hopkins University

 

Collection: Engineering ; Biotechnology

 
84 BRIEF COMMUNICATION c1-Dependent Down-regulation of Recombinant
 

Summary:  that allow depolarization-induced Ca2+ influx into cells. The skeletal muscle L-type CaV channels consist... with the L-type Ca2+ channel (Arikkath et al. 2003). To assess whether this region of the protein allowed... , Mortenson L, Strube C, Campbell KP, Coronado R, Gregg RG (2001) ...

  

Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa

 

Collection: Biology and Medicine

 
85 8 Research Paper Microscopic properties of elementary Ca2++ release sites in non-
 

Summary:  ;23. Lopez-Lopez JR, Shacklock PS, Balke CW, Wier WG: Local calcium transients triggered by single L-type... 8 Research Paper Microscopic properties of elementary Ca2++ release sites in non- excitable cells... § and Martin D. Bootman* Background: Elementary Ca2+ signals, such as `Ca2+ puffs', that arise from

  

Source: Tsien, Roger Y. - Department of Chemistry and Biochemistry, University of California at San Diego

 

Collection: Chemistry

 
86 Calcium Channel Regulation and Presynaptic Plasticity
 

Summary:  by Ca2+ and Calmodulin L-type Ca2+ currents in cardiac myocytes have long been known to be regulated... M-dependent facilita- tion of Ca2+ channel activity (Liang et al., 2003). CaV1.2 channels, which conduct L-type Ca2... global ...

  

Source: Alford, Simon - Department of Biological Sciences, University of Illinois at Chicago

 

Collection: Biology and Medicine

 
87 Cell Calcium 40 (2006) 413422 Imaging single-channel calcium microdomains
 

Summary:  and uni- tary Ca2+ currents associated with depolarization-induced opening of L-type Ca2+ channels in rat... .S. Song, E.G. Lakatta, H. Cheng, Ca2+ signalling between single L-type Ca2+ channels and ryanodine... .C. Amberg, V.S. Votaw, L.F. Santana, Constitutively ...

  

Source: Parker, Ian - Department of Neurobiology and Behavior, University of California, Irvine

 

Collection: Biology and Medicine

 
88 Cellular/Molecular Inhibition of Recombinant N-Type CaV Channels by the 2
 

Summary:  Cellular/Molecular Inhibition of Recombinant N-Type CaV Channels by the 2 Subunit Involves Unfolded... -voltage-activated calcium (CaV ) channels, but their precise regulatory role remains to be determined. In the current report... - iologytoinvestigatetheinfluenceofthe subunitsonneuronalCaV ...

  

Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa

 

Collection: Biology and Medicine

 
89 Perillyl Alcohol Inhibits a Calcium-Dependent Constitutive Nuclear Factor-KB Pathway
 

Summary:  in the WEHI-231 cells. Reverse transcription-PCR amplification of human Cav1.3 (A1D) L-type calcium channel A1... . Sequencing of multiple bacterial clones validated the expression of the Cav1.3 (a1D) LTCC a1- subunit... % homology to the Cav1.3 or ...

  

Source: Gould, Michael N. - Molecular and Cellular Pharmacology Training Program & Department of Oncology, University of Wisconsin at Madison; Miyamoto, Shigeki - Molecular and Cellular Pharmacology Training Program & Department of Pharmacology, University of Wisconsin at Madison

 

Collection: Biology and Medicine

 
90 REGENERATIVE MEDICINE Tracking Stem Cell Differentiation in the Setting
 

Summary:  for primer sequences): L-type a1C; L-type a1D; T-type a1G; T-type a1H; housekeeping gene (Actin). PCR... GTGGTTAGCGTGTCCCTCAT GTGGAGACGGTGAAGAGAGC L-type a1D AATGGCACGGAATGTAGGAG GACGAAAAATGAGCCAAGGA ...

  

Source: Deisseroth, Karl - Departments of Psychiatry and Behavioral Sciences & Bioengineering, Stanford University

 

Collection: Biology and Medicine

 
91 Coleoid cephalopods (octopus, cuttlefish and squid) have high metabolic rates and a relatively low oxygen-carrying
 

Summary:  NCX, Ca2+ carried by the Na+/Ca2+ exchange current; CaICa, Ca2+ carried by the L-type Ca2+ current; C... . and Tort, L. (1998). L-type Ca2+ current and excitation­contraction coupling in single atrial myocytes from... . and ...

  

Source: Altimiras, Jordi - Department of Biology, Linköpings Universitet

 

Collection: Environmental Sciences and Ecology

 
92 A HodgkinHuxley model exhibiting bursting oscillations
 

Summary:  -voltage threshold dihydropyridine-sensitive L-type Ca2+ current (ICa-L), responsible for most of the inward Ca2... respectively. Four ionic currents are included in the model: an L-type voltage-sensitive Ca2+ current ICa... transient contributes additional Ca2+ to ...

  

Source: Reale, Marco - Department of Mathematics and Statistics, University of Canterbury

 

Collection: Mathematics

 
93 Electrically silent divalent cation entries in resting and active voltage-controlled muscle fibers
 

Summary:  L-type channels, pathways involved in these Ca2+ entries remain elusive in adult muscle. This study... skeletal muscle. In working adult muscle, depolarization elicits a well characterized Ca2+ entry through L-type... initiated a Ca2+ entry independent of the voltage-gated ...

  

Source: Ecole Polytechnique, Centre de mathématiques

 

Collection: Mathematics

 
94 Voltage-activated Calcium Currents in Octopus Cells of the Mouse Cochlear Nucleus
 

Summary:  that is largely formed from L-type Ca2+ channels and that P/Q-, N-, and R-type channels are expressed at lower... ; Hille 2001). Most L-type calcium channels that are encoded by genes in the CaV1 family are activated... ). The results of this study demonstrate that L-type ...

  

Source: Kalil, Ronald E. - Neuroscience Training Program & W.M. Keck Laboratory for Biological Imaging, University of Wisconsin at Madison

 

Collection: Biology and Medicine

 
95 Neuron, Vol. 43, 835846, September 16, 2004, Copyright 2004 by Cell Press A CaMKII/Calcineurin Switch Controls the Direction
 

Summary:  ? It was re-baseline allows distinct turning responses to different cently shown that cAMP/cGMP could affect L-type... Neuron, Vol. 43, 835­846, September 16, 2004, Copyright 2004 by Cell Press A Ca... MKII/Calcineurin Switch Controls the Direction of Ca2 -Dependent Growth Cone Guidance 2000; Ming et al., 1997; Song et al

  

Source: Zheng, James Q.- Department of Cell Biology, Emory University

 

Collection: Biology and Medicine

 
96 Elementary [Ca2 ]i signals generated by electroporation
 

Summary:  ., Balke, C. W., and Wier, W. G. (1995) Local calcium transients triggered by single L-type calcium channel... Elementary [Ca2 ]i signals generated by electroporation functionally mimic those evoked by hormonal... of oscillations and global Ca2 waves relies on the spatio-temporal recruit- ment of elementary ...

  

Source: Ljubljana, University of - Faculty of Electrical Engineering, Laboratory of Biocybernetics

 

Collection: Engineering ; Biology and Medicine

 
97 95:2134-2142, 2006. First published Dec 21, 2005; doi:10.1152/jn.01077.2005J Neurophysiol and Rodney L. Parsons
 

Summary:  Ca2 currents through L-type VDCCs (Bhattacharya et al. 2004; Dziema and Obrietan 2002). Because... change did not require Ca2 in- flux through L-type VDCCs. Disruption of Ca2 release from internal stores... it plausible that PACAP might enhance Ca2 influx through ...

  

Source: Parsons, Rodney L. - Department of Anatomy and Neurobiology, University of Vermont

 

Collection: Biology and Medicine

 
98 BioMed Central Page 1 of 10
 

Summary:  + and is regulated by an L-type calcium channel Free [Ca2+]i increase could result from either an influx... + and is regulated by the L-type calcium channel. GABAA receptor mediates the [Ca2+]i rise induced by AP It is well... culture. The AP- induced [Ca2+]i rise was not observed in ...

  

Source: Brinton, Roberta Diaz - Laboratory for Neuroscience Research & School of Pharmacy, University of Southern California

 

Collection: Biology and Medicine

 
99 The Cl to NCl branching ratio in 248-nm photolysis of chlorine azide Alec M. Wodtke a,*, Nils Hansen a,1
 

Summary:  in- terest because one of its photoproducts, NCl(~a 1 D), the isovalent analog of singlet... ! NClð~X3 RÞ þ Ið2 P1=2Þ ð1Þ and slow relaxation of NCl(~a1 D) are important factors in its performance... . The first reported observation of iodine lasing induced by ...

  

Source: Neumark, Daniel M. - Lawrence Berkeley National Laboratory & Department of Chemistry, University of California at Berkeley

 

Collection: Chemistry

 
100 Neuron, Vol. 13, 505-506, September, 1994, Copyright 1994 by Cell Press Matters Arising
 

Summary:  Sensitivity of Native Currents 1S Skeletal muscle HVA L type Sensitive to DHPs, diltiazem and verapamil CaCh1... , HIT cells, GH3 cells, brain, aorta, lung, kidney, fibroblasts HVA L type DHP sensitive Insensitive... HVA L type DHP sensitive ...

  

Source: Campbell, Kevin P. - Department of Physiology and Biophysics, University of Iowa

 

Collection: Biology and Medicine


Page:   1  2  3  4  5