| Sample search results for: 8p22 mtus1 gene |
| 1 | 2008 Wiley-Liss, Inc. American Journal of Medical Genetics Part A 146A:19421954 (2008) Analytical and Clinical Validity of Whole-Genome | ||
|
Summary: .1), RP11-326L2 (MTUS1 gene, 8p22.3), and RP11-970F2 (LOXL2 gene, 8p21.3), RP11-960P19 (TWIST1 gene, 7p21... -1065H22 (MCPH1 gene, 8p23.1), RP11-326L2 (MTUS1 ... |
|||
|
Source: Zhao, Hongyu - School of Public Health, Yale University |
|||
|
Collection: Biology and Medicine |
|||
| 2 | A gene expression signature that can predict the recurrence of tamoxifen-treated primary breast cancer. | ||
|
Summary: as candidate tumor suppressor genes (TSG), namely, AUTS2, GJA1/CX43, MTUS1/ATIP1, PCM1, ITM2B, LRRC17/P37NB... signature Functional class 36-gene signature Cell growth inhibition CX43 *, MTUS1 *, STC2 DNA replication... -like microcephaly-associated protein Mitosis; ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 3 | RESEARCH ARTICLE Open Access Molecular cytogenetic characterization of canine | ||
|
Summary: ), Tumor suppressor candidate 3 (TUSC3), Mito- chondrial Tumor Suppressor gene 1 (MTUS1) and peri... comparative significance, this region of CFA 16 is in part orthologous to human chromosome (HSA) 8p22- p21... : A spontaneous model for human histiocytic cancer ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 4 | Clin Cancer Res . Author manuscript A gene expression signature that can predict the recurrence of | ||
|
Summary: MTUS1/ATIP1 , , , .PCM1 ITM2B LRRC17/P37NB LZTFL1 Among the upregulated genes, 7 were involved... cycle AB033114 MTUS1/ATIP1 * 0.72 -2.78 0.63 Mitochondrial tumor suppressor 1; Angiotensin II receptor... Clin Cancer Res . Author manuscript Page /1 13 A gene expression ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 5 | Available online at www.sciencedirect.com The current excitement about copy-number variation: how it | ||
|
Summary: tumor suppressor gene MTUS1 and familial breast cancer risk. Carcinogenesis 2007, 28:1442-1445. 34... it relates to gene duplications and protein families Jan O Korbel1,2,a , Philip M Kim1,a , Xueying Chen1... rise to CNVs can be considered as fundamental processes underlying gene ... |
|||
|
Source: Gerstein, Mark - Department of Molecular Biophysics and Biochemistry, Yale University |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 6 | www.sciencemag.org/cgi/content/full/318/5851/792/DC1 Supporting Online Material for | ||
|
Summary: Afr VLESEEGRKEYLAFPTSKSSGAGQKGRKDLLKGNGRRIDYILHGEEGLGPDWKA proCap VLENEEGRREYLVFSTSKSSGAGQKGRKGLLKGNGRRIDYILHGEEGLGPDWNA #12;Fig. S6. Gene MTUS1 hom... MTUS1 chr8 near 17,557,778 32 GTCACTGCTTCAACCACCTG TGCGTTTTATACTTCTCWGCTTCTT SH3RF2 chr5 near 145... screened a non-redundant set of ... |
|||
|
Source: Miller, Webb - Departments of Biology & Computer Science and Engineering, Pennsylvania State University |
|||
|
Collection: Biology and Medicine ; Computer Technologies and Information Sciences |
|||
| 7 | DOI: 10.1126/science.1147555 , 792 (2007);318Science | ||
|
Summary: that supported colugos as the closest living relative of primates [Primatomorpha: SPBC25, SMPD3, MTUS1, SH3RF2... ), and Scandentia (treeshrews). We also constructed phylogenetic trees from 14 kilobases of nuclear genes... Genes track to identify rare genomic changes (exonic indels) that would potentially ... |
|||
|
Source: Miller, Webb - Departments of Biology & Computer Science and Engineering, Pennsylvania State University |
|||
|
Collection: Biology and Medicine ; Computer Technologies and Information Sciences |
|||
| 8 | Supplementary Materials for SOS Chenlei Leng | ||
|
Summary: '' are presented here. 1 Brown Data Set Table 1: The chosen top 30 genes for the Brown Data set UID Name GENE313X... ESTs, Weakly similar to open reading frame [M.musculus] GENE3227X HSA272195 centaurinalpha 2 protein... GENE6192X SPINT2 serine protease inhibitor, Kunitz type, 2 ... |
|||
|
Source: Leng, Chenlei - Department of Statistics and Applied Probability, National University of Singapore |
|||
|
Collection: Mathematics |
|||
| 9 | Educational Attainment: A Genome Wide Association Study in 9538 Australians | ||
|
Summary: 8 17630589 INTRONIC MTUS1 4.43E-05 1 47 rs10057387 5 172230003 INTERGENIC RP11-536N17.1 4.49E-05 0... for studies wishing to map genes affecting cognition due to the ease of collecting EA data compared to other... in an independent sample of 968 individuals. A gene-based test of association was then applied ... |
|||
|
Source: Nyholt, Dale R. - Genetic Epidemiology Laboratory, Queensland Institute of Medical Research |
|||
|
Collection: Biology and Medicine |
|||
| 10 | INTRODUCTION Growth hormone is synthesized, stored and secreted by specialized | ||
|
Summary: -pyruvate lyase; sialic acid aldolase) 48 zgc:110708 Hypothetical protein LOC553793 3.1±0.4 0.048 49 mtus1a... of teleost evolution (Jaillon et al., 2004). It is thought 15% of the duplicated genes or paralogues from... of these genes. Fasting-refeeding protocols are commonly used to investigate ... |
|||
|
Source: Johnston, Ian A. - Gatty Marine Laboratory, School of Biology, University of St Andrews |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 11 | BioMed Central Page 1 of 12 | ||
|
Summary: is located in chromosome 8p22-8p21.3, where multiple studies have suggested the existence of a putative... application of microarray technology in disease research is to identify genes differentially expressed... not only by genes, but also by the underlying structure of genetic ... |
|||
|
Source: Zhou, Xianghong Jasmine - Department of Biological Sciences, University of Southern California |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 12 | The human cumulus-oocyte complex gene expression profile | ||
|
Summary: TNFRSF10B/DR5tumornecrosisfactorreceptorsuperfamily,member10b5.9209295_atchr8p22-p21NR TNFRSF12... 1 /37 The human cumulus-oocyte complex gene expression profile Said Assou§,*,, Tal Anahory... -Obstétrique B, Hôpital Arnaud de Villeneuve, MONTPELLIER, F-34000 France. Running Title: Gene ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 13 | IN F LU EN C E OF N ETWOR K TOP OLOGY A N D D A TA C OLLEC TION ON N ETWOR K IN F ER EN C E | ||
|
Summary: network inference algorithm, NETWORKINFERENCE, to recover gene regulatory networks. NETWORKINFERENCE... , but required more data to recover multiple regulators of a gene. When collecting the same number of data... of genes have recently become available due to advances in gene expression array analysis. ... |
|||
|
Source: Smith, V Anne - School of Biology, University of St Andrews |
|||
|
Collection: Environmental Sciences and Ecology ; Computer Technologies and Information Sciences |
|||
| 14 | IN F LU EN C E OF N ETWOR K TOP OLOGY A N D D A TA C OLLEC TION ON N ETWOR K IN F ER EN C E | ||
|
Summary: network inference algorithm, NETWORKINFERENCE, to recover gene regulatory networks. NETWORKINFERENCE... , but required more data to recover multiple regulators of a gene. When collecting the same number of data... of genes have recently become available due to advances in gene expression array analysis. ... |
|||
|
Source: Hartemink, Alexander - Center for Bioinformatics and Computational Biology & Department of Computer Science, Duke University |
|||
|
Collection: Biotechnology ; Computer Technologies and Information Sciences |
|||
| 15 | IN F LU EN C E OF N ETWOR K TOP OLOGY A N D D A TA C OLLEC TION ON N ETWOR K IN F ER EN C E | ||
|
Summary: network inference algorithm, NETWORKINFERENCE, to recover gene regulatory networks. NETWORKINFERENCE... , but required more data to recover multiple regulators of a gene. When collecting the same number of data... of genes have recently become available due to advances in gene expression array analysis. ... |
|||
|
Source: Jarvis, Erich D. - Department of Neurobiology, Duke University |
|||
|
Collection: Biology and Medicine |
|||
| 16 | Research Article Estimation of synteny conservation and | ||
|
Summary: ®nity cationic amino acid transporter 8p22 123I02 0 1 aC11 BTG1 B-cell translocation 1 12q22 aE5 TEF Thyrotroph... : Knowledge of the amount of gene order and synteny conservation between two species gives insights... genes showed an eight-fold average size reduction in Fugu, consistent ... |
|||
|
Source: McLysaght, Aoife - Genetics Department, Trinity College, University of Dublin; Wolfe, Kenneth H. - Genetics Department, Trinity College, University of Dublin |
|||
|
Collection: Biotechnology ; Environmental Sciences and Ecology |
|||
| 17 | Identification of the Gene for a Novel Liver-Related Putative Tumor Suppressor at a High-Frequency Loss of Heterozygosity Region | ||
|
Summary: on 8p22. Genes, Chromosomes & Cancer 1999;25:1-5. 33. Gustafson CE, Wilson PJ, Lukeis R, Baker E... deleted regions, namely 8p21 (13 centi Mor- gan [cM]), 8p22 (9 cM), and 8p23 (5 cM).10 The microsatel... at chromosome ... |
|||
|
Source: Tian, Weidong - Institute of Biochemistry and Cell Biology, Shanghai Institute of Biological Sciences |
|||
|
Collection: Biology and Medicine |
|||
| 18 | Highthroughput soybean gene expression analysis The changes in the atmosphere are altering gene expression and affecting the interaction | ||
|
Summary: Highthroughput soybean gene expression analysis The changes in the atmosphere are altering gene... soybean oligoarrays to analyze changes in the gene expression profile. Affymetrix GeneChip® Soybean Genome... with Virus Induced Gene Silencing (VIGS) VIGS is used to suppress ... |
|||
|
Source: DeLucia, Evan H. - Department of Plant Biology, University of Illinois at Urbana-Champaign |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 19 | Klaas Vandepoele, Yvan Saeys, Cedric Simillion, Jeroen Raes and Yves Van de Peer Bioinformatics Research Group, Department of Plant Genetics, Flanders Interuniversity Institute for Biotechnology (VIB), Ghent University, | ||
|
Summary: the degree of gene conservation between Arabidopsis1 and Rice, two distantly related species which diverged... around 33.000 genes using the RiceGAAS gene annotation system2) were used in the comparison... with Arabidopsis. In order to detect large segments of conserved gene content, clusters of overlapping ... |
|||
|
Source: Gent, Universiteit - Department of Plant Systems Biology, Bioinformatics and Evolutionary Genomics Division |
|||
|
Collection: Biology and Medicine |
|||
| 20 | BIOINFORMATICS Vol. 19 Suppl. 1 2003, pages i222i224 DOI: 10.1093/bioinformatics/btg1030 | ||
|
Summary: BIOINFORMATICS Vol. 19 Suppl. 1 2003, pages i222i224 DOI: 10.1093/bioinformatics/btg1030 Gene... yet exists. Results: GeneLoc, software adjunct to GeneCards and UDB, integrates gene lists... by comparing genomic coordi- nates at the exon level and assigns unique and meaningful identifiers to each ... |
|||
|
Source: Lancet, Doron - Department of Molecular Genetics, Weizmann Institute of Science; Pilpel, Yitzhak - Department of Molecular Genetics, Weizmann Institute of Science |
|||
|
Collection: Biology and Medicine |
|||
| 21 | Reverse Engineering Algorithm transcription | ||
|
Summary: Engineering of Nonlinear Gene Networks Thomas Scha ter, Prof. Dario Floreano Microengineering Laboratory... molecular biology techniques provide gene expression (mRNA) levels of selected genes of an organism... . In such aggregate, the mRNA level of one gene is mediated by the presence of speci c proteins and ... |
|||
|
Source: Lausanne, Ecole Polytechnique Fédérale de - Processor Architecture Laboratory |
|||
|
Collection: Engineering ; Computer Technologies and Information Sciences |
|||
| 22 | Supplementary Table 1 status number of regions calls in A calls in B calls in C calls in D calls in E average | ||
|
Summary: Engineering of Nonlinear Gene Networks Thomas Scha ter, Prof. Dario Floreano Microengineering Laboratory... molecular biology techniques provide gene expression (mRNA) levels of selected genes of an organism... . In such aggregate, the mRNA level of one gene is mediated by the presence of speci c proteins and ... |
|||
|
Source: Pennsylvania, University of - Center for Clinical Epidemiology and Biostatistics |
|||
|
Collection: Biology and Medicine |
|||
| 23 | JOURNAL OF BACTERIOLOGY, Sept. 1995, p. 53685369 Vol. 177, No. 18 0021-9193/95/$04.00 0 | ||
|
Summary: 1995, American Society for Microbiology The Distance between Escherichia coli Genes Is Related to Gene... Escherichia coli genes oriented in the same direction on the chromo- some is positively correlated... to the expression level of the downstream gene. It is suggested that this could be a strategy to ... |
|||
|
Source: Eyre-Walker, Adam - Department of Biology and Environmental Science, University of Sussex |
|||
|
Collection: Biology and Medicine |
|||
| 24 | RESOVING THE GENE TREE AND SPECIES TREE PROBLEM BY PHYLOGENETIC MINING | ||
|
Summary: RESOVING THE GENE TREE AND SPECIES TREE PROBLEM BY PHYLOGENETIC MINING XIAOXU HAN Department... of Mathematics and Bioinformatics Program, Eastern Michigan University Ypsilanti, MI 48197, USA The gene tree... and species tree problem remains a central problem in phylogenomics. To overcome this problem, gene |
|||
|
Source: Wong, Limsoon - Department of Computational Science, National University of Singapore |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 25 | Chapter 19: Entrez Gene: A Directory of Genes Donna Maglott | ||
|
Summary: Chapter 19: Entrez Gene: A Directory of Genes Donna Maglott Kim Pruitt Tatiana Tatusova Summary... A major goal of genomic sequencing projects is to identify and characterize genes. Entrez Gene (1) has... information about genes, serving as a major node in the nexus of genomic map, ... |
|||
|
Source: Levin, Judith G. - Laboratory of Molecular Genetics, National Institutes of Health |
|||
|
Collection: Biology and Medicine |
|||
| 26 | Evolution of vertebrate genome organisation | ||
|
Summary: rearrangement . . . . . . . . . 4 1.2.2 Gene order evolution . . . . . . . . . . . . . . . . . . . 6 1.2.3 Human... .3.1 Genome duplication . . . . . . . . . . . . . . . . . . . 16 1.3.2 The fate of duplicated genes... .2.3 Genome maps . . . . . . . . . . . . . . . . . . . . . . . 43 2.3 Dating gene duplications |
|||
|
Source: McLysaght, Aoife - Genetics Department, Trinity College, University of Dublin; Wolfe, Kenneth H. - Genetics Department, Trinity College, University of Dublin |
|||
|
Collection: Biotechnology ; Environmental Sciences and Ecology |
|||
| 27 | MICROBIoLOGICAL REVIEWS, June 1978, p. 385-413 0146-0749/78/0042-0385$02.00/0 | ||
|
Summary: ORGANIZATION OF THE P22 GENOME......................... .. 386 Gene Order and Gene Function... c genes .............................. 399 cly mutations .............................. 400... 400 Host genes ........... 401 Integration and Excision of Prophage |
|||
|
Source: Botstein, David - Lewis-Sigler Institute for Integrative Genomics & Department of Molecular Biology, Princeton University |
|||
|
Collection: Biology and Medicine |
|||
| 28 | Volunteers needed for Research study | ||
|
Summary: School seek healthy volunteers to participate in a study on the effects of genes on brain function... between genes and brain function, then, for more details please Contact: (617) 643-7273 or genes... .brain@gmail.com MGHStudy 617-643-7273 genes.brain@gmail.com MGHStudy 617-643-7273 ... |
|||
|
Source: Bar, Moshe - NMR Athinoula A. Martinos Center, Massachusetts General Hospital, Harvard University |
|||
|
Collection: Biology and Medicine |
|||
| 29 | Construction of Metagenes by Conditional Factor Analysis Andreas Mayr, Djork-Arne Clevert, Andreas Mitterecker, An De Bondt, Willem Talloen, Hinrich Ghlmann, | ||
|
Summary: Mitterecker, An De Bondt, Willem Talloen, Hinrich Göhlmann, Sepp Hochreiter Gene selection for classification... microarray data is important to improve a classifier, to find new drug targets, or to design predictive gene... signatures. However, gene selection has a very bad reputation. One reason is the "selection bias" of ... |
|||
|
Source: Hochreiter, Sepp - Institute of Bioinformatics, Johannes Kepler Universität Linz |
|||
|
Collection: Biology and Medicine ; Computer Technologies and Information Sciences |
|||
| 30 | BIOINFORMATICS APPLICATIONS NOTE Vol. 20 no. 9 2004, pages 14571458 | ||
|
Summary: /bth081 GeneAnnot: comprehensive two-way linking between oligonucleotide array probesets and Gene... Cards genes Vered Chalifa-Caspi1, Itai Yanai2, Ron Ophir1, Naomi Rosen2, Michael Shmoish2, Hila Benjamin... assigned to one gene. However, in reality, subsets of oligonuc- leotides in a probeset may match ... |
|||
|
Source: Lancet, Doron - Department of Molecular Genetics, Weizmann Institute of Science |
|||
|
Collection: Biology and Medicine |
|||
| 31 | Legend to supporting material Supporting Table 2. A hierarchy of gene-pair characteristics. Characteristics are followed by the number of gene | ||
|
Summary: Legend to supporting material Supporting Table 2. A hierarchy of gene-pair characteristics... . Characteristics are followed by the number of gene pairs known to possess that characteristic. As in the Gene... Ontology, if a gene pair possesses a characteristic, it possesses all parents of that characteristic |
|||
|
Source: Bussey, Howard - Department of Biology, McGill University |
|||
|
Collection: Biology and Medicine |
|||
| 32 | out of Africa (5, 19, 20). The possibility that human history has been characterized | ||
|
Summary: their activities. But it will not be easy. To paraphrase Hayles (8, p. 22), anno- tations, insofar... - stimulating hormone receptor gene (MC1R) suggests that various alleles of this single locus may underlie much... - es" is likely to be due to similarly straight- forward mechanisms, involving limited numbers ... |
|||
|
Source: Boguski, Mark S. - Center for Biomedical Informatics, Harvard University |
|||
|
Collection: Mathematics ; Biology and Medicine |
|||
| 33 | An overview of the information to be gathered for the bioinformatics assignment A. INFORMATION ON PATENTS | ||
|
Summary: . INFORMATION ON YOUR CHOSEN GENE AND DISEASE GATHERED FROM OMIM (1) What is the inheritance pattern... of the disease? (2) What is the name of the gene(s) thought to be involved in causing the disease? (3) Which... of these genes, if there are several, have you chosen to examine? Why did you make this selection? (4) What types |
|||
|
Source: Barrette-Ng, Isabelle - Department of Biological Sciences, University of Calgary |
|||
|
Collection: Biology and Medicine |
|||
| 34 | Visualization of Gene Combinations Christian Tominski & Heidrun Schumann | ||
|
Summary: Visualization of Gene Combinations Christian Tominski & Heidrun Schumann University of Rostock... · Microarrays are fundamental technology · Huge volumes of microarray data collected: Gene Expression Omnibus... Significance Analysis Self-Organizing Maps #12;Background · Microarray data Set of genes: G Set of samples |
|||
|
Source: Tominski, Christian - Institut für Informatik, Universität Rostock |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 35 | Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome | ||
|
Summary: MRPL49P2 AY135275 8p22 16.77M ( ) 0.30 0.032 1166 100% 61% Proc MRPL50 NM_019051 9q31.1 93.10M... correlation between the number of processed pseudogenes and the gene CDS length (R 0.40; p 0.001), i... .e., the relatively shorter genes tend to have more processed pseudogenes. There is ... |
|||
|
Source: Gerstein, Mark - Department of Molecular Biophysics and Biochemistry, Yale University; Zhang, ZhaoLei - Banting and Best Department of Medical Research, University of Toronto |
|||
|
Collection: Biology and Medicine ; Biotechnology |
|||
| 36 | Relationships between gene expression and brain wiring in the adult rodent brain Leon French and Paul Pavlidis | ||
|
Summary: Relationships between gene expression and brain wiring in the adult rodent brain Leon French... and guidance signals. To examine the global relationships between gene expression and neuroanatomical... connectivity we examine large scale gene expression signatures in the adult rodent brain. The analysis |
|||
|
Source: Sahinalp, S. Cenk - School of Computing Science, Simon Fraser University |
|||
|
Collection: Biology and Medicine ; Computer Technologies and Information Sciences |
|||
| 37 | Seminar Series Matthew L. Robison | ||
|
Summary: to identify genes that are differentially expressed in the marine diatom, T. pseudonana, during conditions... of silica starvation in an attempt to identify genes involved in the cell wall synthesis process. Thirteen... genes were identified as repressed and forty-two genes were identified as induced under ... |
|||
|
Source: Payseur, Bret - Department of Medical Genetics, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine |
|||
| 38 | Testing Groups of Genes Manuela Hummel, LMU Munchen | ||
|
Summary: Testing Groups of Genes Manuela Hummel, LMU M¨unchen Adrian Alexa, MPI Saarbr¨ucken Ulrich Mansmann... Analysis of groups of genes · Motivation · How to define gene groups · Assess relevance of gene groups... Group testing methods · Gene set enrichment: Fisher-test, GSEA · Holistic ... |
|||
|
Source: Spang, Rainer - Computational Molecular Biology Group, Max Planck Institute for Molecular Genetics |
|||
|
Collection: Computer Technologies and Information Sciences ; Biotechnology ; Biology and Medicine |
|||
| 39 | The genetic code of gene regulatory elements Ivan Ovcharenko | ||
|
Summary: The genetic code of gene regulatory elements Ivan Ovcharenko Computational Biology Branch National... Center for Biotechnology Information National Institutes of Health October 23, 2008 #12;· Gene deserts... and distant gene regulation · Genetic encryption of gene regulation · Heart regulatory code Outline ... |
|||
|
Source: Singh, Jaswinder Pal - Department of Computer Science, Princeton University |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 40 | Diagnosis using One disease | ||
|
Summary: in each arm 30.000 genes on the chip A B #12;Are there any differences between the gene expression... profiles of type A patients and type B patients? 30.000 genes are a lot. That's to complex to start... with Let`s start with considering only two genes: gene A und ... |
|||
|
Source: Spang, Rainer - Computational Molecular Biology Group, Max-Planck-Institut für molekulare Genetik |
|||
|
Collection: Computer Technologies and Information Sciences ; Biotechnology ; Biology and Medicine |
|||
| 41 | An Automated Comparative Analysis of Seventeen Complete Microbial Arvind K. Bansal | ||
|
Summary: to identify orthologs and gene-groups to derive orthologous genes in a group of genomes, to identify genes... with conserved functionality, and to identify genes specific to groups of genomes. Seventeen microbial genomes... to derive orthologs, orthologous gene-groups, duplications, ... |
|||
|
Source: Bansal, Arvind K. - Department of Computer Science, Kent State University |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 42 | Nucleic Acids Research, 2007, 111 doi:10.1093/nar/gkm054 | ||
|
Summary: 1q25.3 8p22 0.00EÀ0 PS2 Alzheimer disease 0 1 1 0 1q42.13 1q42.1 0.24EÀ2 On this chromosome, five... , anatomy, development and Gene Ontology branches. The association between a band (e.g. 4p16... to interpret and report cytogenetic findings and support research- ers interested in human ... |
|||
|
Source: Leuven, Katholieke Universiteit, Department of Electrical Engineering, SCD Division |
|||
|
Collection: Engineering |
|||
| 43 | CLASS 1.4: 01/30/07 GENOME ORGANIZATION II | ||
|
Summary: 1 CLASS 1.4: 01/30/07 GENOME ORGANIZATION II A. Genome Sequences and Gene Numbers (cont): 1. Model... eukaryotic systems - Lot is known - Genome sequence can directly test theories about genes - Most common... size of gene - Major differences = i. baker's = ii. brewer's = #12;2 b. Nematode worms (C. elegans |
|||
|
Source: Andres, Andrew - School of Life Sciences, University of Nevada at Las Vegas |
|||
|
Collection: Biology and Medicine |
|||
| 44 | Controlled Chaos of Polymorphic Mucins in a Metazoan Parasite (Schistosoma mansoni) Interacting with Its | ||
|
Summary: polymorphism to SmPoMuc. We show that SmPoMuc is coded by a multi- gene family whose members frequently... recombine. We show that these genes are transcribed in an individual-specific manner, and that for each gene... of genes. This contrasts with protozoan parasites that generate antigenic variation from ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 45 | Evolutionary dynamics of olfactory receptor genes in fishes and tetrapods | ||
|
Summary: Evolutionary dynamics of olfactory receptor genes in fishes and tetrapods Yoshihito Niimura... by a large multigene family of olfactory receptor (OR) genes. Fishes also have this gene family... , but the number of genes is known to be substantially smaller than in mammals. To understand the evolutionary |
|||
|
Source: Nei, Masatoshi - Department of Biology, Pennsylvania State University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 46 | Research Article All Human-Specific Gene Losses Are Present | ||
|
Summary: Research Article All Human-Specific Gene Losses Are Present in the Genome as Pseudogenes DANIEL R... . SCHRIDER, JAMES C. COSTELLO, and MATTHEW W. HAHN ABSTRACT The loss of previously established genes has been... the opportunity to identify cases of gene loss, it is unclear which algorithms offer the greatest accuracy |
|||
|
Source: Hahn, Matthew - School of Informatics & Department of Biology, Indiana University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 47 | Evolutionary changes of the number of olfactory receptor genes in the human and mouse lineages | ||
|
Summary: Evolutionary changes of the number of olfactory receptor genes in the human and mouse lineages... Received by T. Gojobori Abstract The numbers of functional olfactory receptor (OR) genes are quite variable... among mammalian species. Previously we have reported that humans have 388 functional OR genes and 414 |
|||
|
Source: Nei, Masatoshi - Department of Biology, Pennsylvania State University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 48 | Appendix D: Knowledge Questions 1. You are investigating the changes in gene expression in cancer cells compared to normal cells | ||
|
Summary: Appendix D: Knowledge Questions 1. You are investigating the changes in gene expression in cancer... amplify the genes for photosynthesis in the presence of dye-labeled nucleotides and incubate the products... cannot make a reasonable guess. 5. The figure shows the ratio of gene expression at the indicated time |
|||
|
Source: Campbell, A. Malcolm - Biology Department, Davidson College |
|||
|
Collection: Multidisciplinary Databases and Resources ; Biology and Medicine |
|||
| 49 | Genome-wide Analysis of Polymorphic Differences That Affect Gene Expression | ||
|
Summary: Genome-wide Analysis of Polymorphic Differences That Affect Gene Expression Leonid Kruglyak Ecology... & Evolutionary Biology Princeton University Natural genetic variation can cause significant differences in gene... , little is known regarding the mechanisms by which natural polymorphisms affect gene regulation. To begin |
|||
|
Source: Singh, Jaswinder Pal - Department of Computer Science, Princeton University |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 50 | The -Catenin Pathway is Activated in Focal Nodular Hyperplasia but not in Cirrhotic FNH-like Nodules | ||
|
Summary: analysis.Methods: Gene expression profiles obtained in FNH and normal livers were compared. Differentially... -expressed genes were validated using quantitative-RT-PCR in 70 benign liver tumors including FNH-like lesions... . Results: Among the deregulated genes in FNHs, 19 displayed physiological restricted distribution |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 51 | Gene Help: Integrated Access to Genes of Genomes in the Reference Sequence Collection | ||
|
Summary: Gene Help: Integrated Access to Genes of Genomes in the Reference Sequence Collection Garth Brown... Craig Wallin Tatiana Tatusova Kim Pruitt Donna Maglott Introduction Gene supplies gene... . Unique identifiers are assigned to genes with defining sequences, genes with ... |
|||
|
Source: Levin, Judith G. - Laboratory of Molecular Genetics, National Institutes of Health |
|||
|
Collection: Biology and Medicine |
|||
| 52 | In Silico Biology 7 (2007) 467483 467 Clustering Formal Concepts to Discover | ||
|
Summary: Biologically Relevant Knowledge from Gene Expression Data Sylvain Blachona,b , Ruggero G. Pensab , J... 2007; published 16 July 2007 ABSTRACT: The production of high-throughput gene expression data has... pattern discovery. We propose here an original way to discover knowledge from gene expression data |
|||
|
Source: Boulicaut, Jean-François - Institut National des Sciences Appliquées de Lyon & Laboratoire d'InfoRmatique en Image et Systèmes d'information, Université Claude Bernard (Lyon I) |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 53 | Estimation of gene conversion rates in small gene families Proposer: Jay Taylor | ||
|
Summary: Estimation of gene conversion rates in small gene families Proposer: Jay Taylor Gene families... are sets of genes, belonging to the same genome, which encode related proteins. Examples from the human... genome include the MHC genes (involved in adaptive immunity), the opsins (involved in ... |
|||
|
Source: Goldschmidt, Christina - Department of Statistics, University of Warwick |
|||
|
Collection: Mathematics |
|||
| 54 | Estimating the number of essential genes in a genome by random transposon mutagenesis | ||
|
Summary: Estimating the number of essential genes in a genome by random transposon mutagenesis Natalie J... 29 July 2002 We describe a Bayesian method for estimating the number of essential genes in a genome... in a genome, potentially disrupting a gene. The prior distribution for the number of essential genes was ... |
|||
|
Source: Broman, Karl W. - Department of Biostatistics and Medical Informatics, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine |
|||
| 55 | Version 1.2, April 2007 Cristian I. Castillo-Davis | ||
|
Summary: 1 GeneMerge Version 1.2, April 2007 Cristian I. Castillo-Davis Copyright © 2007 by Cristian I... : Castillo-Davis, C. I. and D. L. Hartl. 2003. GeneMerge-- post-genomic analysis, data-mining and hypothesis... testing. Bioinformatics 19(7):891-892 http://www.oeb.harvard.edu/hartl/lab/publications/Gene |
|||
|
Source: Castillo-Davis, Cristian I. - Department of Biology, University of Maryland at College Park |
|||
|
Collection: Biology and Medicine |
|||
| 56 | Uneven size distribution of mammalian genes in the number of tissues expressed and in the number | ||
|
Summary: Uneven size distribution of mammalian genes in the number of tissues expressed and in the number... of co-expressed genes Song Liu, Chi Zhang and Yaoqi Zhou* Department of Physiology and Biophysics... , 2006 Tissue specificity, the traditional predictor of gene function, has recently been used |
|||
|
Source: Zhou, Yaoqi - School of Informatics, Indiana University |
|||
|
Collection: Biology and Medicine |
|||
| 57 | Clustering formal concepts to discover biologically relevant knowledge... http://www.bioinfo.de/isb/2007/07/0033/main.html 1 sur 16 30/11/2007 20:57 | ||
|
Summary: , Bioinformation Systems e.V. Clustering formal concepts to discover biologically relevant knowledge from gene... ; accepted June 16, 2007; published July 16, 2007 Abstract The production of high-throughput gene expression... on local pattern discovery. We propose here an original way to discover knowledge from gene expression ... |
|||
|
Source: Robardet, Céline - Laboratoire d'InfoRmatique en Image et Systèmes d'information, Université Claude Bernard (Lyon I) |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 58 | Kernel Machine SNP-set Analysis for Censored Survival Outcomes in Genome-wide Association Studies | ||
|
Summary: -set test (using the linear kernel) and the min test for the ASAH1 gene. The ASAH1 gene is on 8p22-p21... than the kernel machine method using the NAT2 gene. NAT2 lies on 8p22 and has 22 HapMap SNPs and ... |
|||
|
Source: Lin, Xihong - Department of Biostatistics, Harvard University |
|||
|
Collection: Biology and Medicine |
|||
| 59 | Functional Epigenomics Identifies Genes Frequently Silenced in Prostate Cancer | ||
|
Summary: necrosis factor receptor 10b TNFRSF10B 8p22 D apoptosis no Cyclin-dependent kinase inhibitor 1C (p57, Kip2... arrest-specific 2 like 1 GAS2L1 22q12.2 L unknown no Deleted in liver cancer 1 DLC1 8p22 D unknown no Ras... Functional Epigenomics Identifies ... |
|||
|
Source: Hermeking, Heiko - Max-Planck-Institut für Biochemie |
|||
|
Collection: Biology and Medicine |
|||
| 60 | A Critical Review of Gene Prediction Software | ||
|
Summary: A Critical Review of Gene Prediction Software Mark McElwain Bioc 218 Final Paper March 19, 2007 #12... sequenced numbering over one hundred, it is clear that quick, accurate annotation of predicted genes... between species. In the days of classical, forward genetics, the presence of a gene was inferred from |
|||
|
Source: Bejerano, Gill - Departments of Computer Science & Developmental Biology, Stanford University |
|||
|
Collection: Computer Technologies and Information Sciences ; Biology and Medicine |
|||
| 61 | Frequent occurrence of uniparental disomy in colorectal cancer Claus Lindbjerg Andersen, Carsten Wiuf, | ||
|
Summary: 8p22 13.30 15.45 2.15 67 Yes 2 0 0 0 5 8q21 87.84 91.40 3.56 27 No 8 4 0 2 6 8q22q23 104.39 106... showed that genes in regions with increased copy number (including 7p and 20q) were predominantly... course, e.g. markers of lymph node involvement or TP53 tumor suppressor gene mutation. ... |
|||
|
Source: Wiuf, Carsten - Bioinformatics Research Center, University of Aarhus |
|||
|
Collection: Biotechnology |
|||
| 62 | speciesDrosophilaEvolutionary dynamics of olfactory receptor genes in Masafumi Nozawa, and Masatoshi Nei | ||
|
Summary: speciesDrosophilaEvolutionary dynamics of olfactory receptor genes in Masafumi Nozawa... .pnas.org/misc/reprints.shtml To order reprints, see: Notes: #12;Evolutionary dynamics of olfactory receptor genes in Drosophila species... , March 7, 2007 (sent for review February 23, 2007) Olfactory receptor (OR) genes are of vital ... |
|||
|
Source: Nei, Masatoshi - Department of Biology, Pennsylvania State University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 63 | Please type no handwritten forms accepted R-DNA Creation of Transgenic Animals | ||
|
Summary: to make the transgenics? Microinjection of gene construct into pronuclear fertilized oocytes Insertion... of gene construct into embryonic stem cells that are microinjected into oocytes B) We will make our... ? Microinjection of gene construct into pronuclear fertilized oocytes Insertion of gene construct ... |
|||
|
Source: Fang, Yuguang "Michael" - Department of Electrical and Computer Engineering, University of Florida |
|||
|
Collection: Engineering ; Computer Technologies and Information Sciences |
|||
| 64 | Supplementary data Distinct Properties of Human Disease Genes in Protein Interaction | ||
|
Summary: Page | 1 Supplementary data Distinct Properties of Human Disease Genes in Protein Interaction... ,543 connections. The layout was done using Pajek (http://pajek.imfm.si/). Mendelian disease genes in hOMIM data... of nondisease, Mendelian and complex disease genes. The number of genes belong to 19 different ... |
|||
|
Source: Borenstein, Elhanan - Department of Genome Sciences, University of Washington at Seattle |
|||
|
Collection: Biology and Medicine |
|||
| 65 | Mol. Biol. Evol. 19(3):336340. 2002 2002 by the Society for Molecular Biology and Evolution. ISSN: 0737-4038 | ||
|
Summary: al. 1997 Lp1. . . . . . . 8 p22 Intron 142 9734 0.147 2.26 2.0 1.48 40.8 Clark et al. 1998 Hox B6... . ISSN: 0737-4038 Letter to the Editor Gene Density and Human Nucleotide Polymorphism Bret A. Payseur... . E-mail: payseur@email.arizona.edu. gene density. If selection acts primarily on ... |
|||
|
Source: Dean, Matthew D. - Department of Ecology and Evolutionary Biology, University of Arizona; Nachman, Michael - Department of Ecology and Evolutionary Biology, University of Arizona; Payseur, Bret - Department of Medical Genetics, University of Wisconsin at Madison |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 66 | Genome sequence of the Brown Norway rat yields insights into | ||
|
Summary: includes genes and proteins and their relation to human disease, repeated sequences, comparative genome... -specific and lineage- independent evolutionary events such as expansion of gene families, orthology relations... genomes encode similar numbers of genes. The majority have persisted without deletion or duplication since |
|||
|
Source: Batzoglou, Serafim - Department of Computer Science, Stanford University; Hardison, Ross C. - Department of Biochemistry and Molecular Biology, Pennsylvania State University; Payseur, Bret - Department of Medical Genetics, University of Wisconsin at Madison; Seaman, Michael I. - Department of Biological Sciences, Duquesne University; Sidow, Arend - Department of Genetics, Stanford University |
|||
|
Collection: Biology and Medicine ; Biotechnology ; Computer Technologies and Information Sciences |
|||
| 67 | The search for genes contributing to endometriosis risk Grant W. Montgomery1,7, Dale R. Nyholt1, Zhen Zhen Zhao1, Susan A. Treloar1, | ||
|
Summary: /1 NAT2 8p22 2 2 2/4 PPARG 3p25 2 0 2/2 Hormone receptors AR Xq12 1 1 1/2 ESR1 6q24-27 5c 4 5/9d ESR2 14q... for the detoxification enzymes N-acetyltransferase 2 (arylamine N-acetyltransferase) (NAT2) on chromosome 8p22... The search for genes ... |
|||
|
Source: Nyholt, Dale R. - Genetic Epidemiology Laboratory, Queensland Institute of Medical Research |
|||
|
Collection: Biology and Medicine |
|||
| 68 | Virtual Gene: a Gene Selection Algorithm for Sample Classification on Microarray Datasets | ||
|
Summary: Virtual Gene: a Gene Selection Algorithm for Sample Classification on Microarray Datasets Xian Xu... , USA Abstract. Gene Selection is one class of most used data analysis algorithms on microarray dataset... . The goal of gene selection algorithms is to filter out a small set of informative ... |
|||
|
Source: Buffalo, State University of New York - Department of Computer Science and Engineering, Bioinformatics, Database, Data Mining, and Multimedia Group |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 69 | Various Aspects of a ________________ etc can Also be Anotated These Include Things Like Regulatory Regions, the Promoter, the Untranslated Regions, | ||
|
Summary: the Function of Genes and other Regulatory Regions This Consequently concerns the _____________________ i... .e. the Expressed (Used) Part of the Genome; Genes etc #12;When a New Genome Sequence is Obtained... and ___________________ are Identified The First Thing to be Done is to Try to Identify the Genes Using _______________ ... |
|||
|
Source: Cutler, Chris - Department of Biology, Georgia Southern University |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 70 | GeneFetch : enriching Department of Plant Systems Biology, VIB, Technologiepark 927, 9052 Gent, Belgium | ||
|
Summary: GeneFetch : enriching 1 Department of Plant Systems Biology, VIB, Technologiepark 927, 9052 Gent... necessity. We present GeneFetch, a system that enables biologists to easily find and browse vital... information on any gene or group of genes. A knowledge base is constructed automatically by retrieving facts |
|||
|
Source: Gent, Universiteit - Department of Plant Systems Biology, Bioinformatics and Evolutionary Genomics Division |
|||
|
Collection: Biology and Medicine |
|||
| 71 | How To Filter Genes October 16, 2005 | ||
|
Summary: How To Filter Genes October 16, 2005 Introduction The genefilter package can be used to filter... (select) genes from a microarray experiment according to a wide variety of different filtering mechanisms... . This experiment has 26 samples, there are 500 genes and 3 covariates. The covariates are named cov1, cov2 and cov3 |
|||
|
Source: Bain, Mike - School of Computer Science and Engineering, University of New South Wales |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 72 | Higher Duplicability of Less Important Genes in Yeast Genomes Xionglei He and Jianzhi Zhang | ||
|
Summary: Higher Duplicability of Less Important Genes in Yeast Genomes Xionglei He and Jianzhi Zhang... Department of Ecology and Evolutionary Biology, University of Michigan, Ann Arbor Gene duplication plays... an important role in evolution because it is the primary source of new genes. Many recent studies showed |
|||
|
Source: Zhang, Jianzhi - Department of Ecology and Evolutionary Biology, University of Michigan |
|||
|
Collection: Biology and Medicine |
|||
| 73 | Copyright 2008 by the Genetics Society of America DOI: 10.1534/genetics.108.090936 | ||
|
Summary: Copyright Ó 2008 by the Genetics Society of America DOI: 10.1534/genetics.108.090936 Note Gene... Dosage and Gene Duplicability Wenfeng Qian and Jianzhi Zhang1 Department of Ecology and Evolutionary... for publication June 3, 2008 ABSTRACT The evolutionary process leading to the fixation of newly duplicated genes |
|||
|
Source: Zhang, Jianzhi - Department of Ecology and Evolutionary Biology, University of Michigan |
|||
|
Collection: Biology and Medicine |
|||
| 74 | GeneXPress: A Visualization and Statistical Analysis Tool for Gene Expression and Sequence | ||
|
Summary: GeneXPress: A Visualization and Statistical Analysis Tool for Gene Expression and Sequence Data E... gene expression and sequence data. However, to extract biological un- derstanding, scientists often... , we present GeneXPress, a tool designed to facilitate the assginment of biological meaning to ... |
|||
|
Source: Friedman, Nir - School of Computer Science and Engineering, Hebrew University of Jerusalem |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 75 | Genes in the environment Genes and Ecosystems | ||
|
Summary: Genes in the environment Genes and Ecosystems Dr Eshwar Mahenthiralingam (Esh) Cardiff University... #12;Genes in the environment Ecosystems (food, medicine, soil regeneration, waste recirculation... , nutrient cycling) Genes (Functional proteins and enzyme pathways involved in the natural processes |
|||
|
Source: Edinburgh, University of - School of Biological Sciences, Evolutionary Ecology of Animal Cognition Group |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 76 | Interactive Poster: Visualization of Gene Combinations Christian Tominski Clemens Holzhuter Andrea Unger Heidrun Schumann | ||
|
Summary: Interactive Poster: Visualization of Gene Combinations Christian Tominski Clemens Holzh¨uter Andrea... of microarray data is a key to understanding the influ- ence and role of genes. Visualization is one way... to support analysts in finding potentially important genes. However, most visualiza- tion tools focus |
|||
|
Source: Tominski, Christian - Institut für Informatik, Universität Rostock |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 77 | Genome Biology 2007, 8:R158 commentreviewsreportsdepositedresearchrefereedresearchinteractionsinformation | ||
|
Summary: mechanisms of recent gene duplications in the human and mouse genomes: a novel strategy to estimate gene... . Gene duplication rates By studying two mechanisms of gene duplication, unequal crossover... and retrotranspostion, and looking at both small gene families andthe entire ... |
|||
|
Source: Zhang, Liqing - Department of Computer Science, Virginia Tech |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 78 | From a gene list to biological function testing functional groups of genes | ||
|
Summary: From a gene list to biological function testing functional groups of genes Adrian Alexa alexa... in Practical DNA Microarray Analysis, M¨unchen, May 12, 2005 #12;Group Testing Gene lists The Microarray... experiments provide a long list of genes. Typical studies analyze genes one ... |
|||
|
Source: Spang, Rainer - Computational Molecular Biology Group, Max-Planck-Institut für molekulare Genetik |
|||
|
Collection: Computer Technologies and Information Sciences ; Biotechnology ; Biology and Medicine |
|||
| 79 | Summer 2009 Research Proposal Drosophila melanogaster Annotation: Discovering the Function of a Gene | ||
|
Summary: of a Gene Jeanine Schibler March 27,2009 #12;For summer 2009,1 would like to propose a research project... to discover the function of gene CG- I I I48, a feature on chromosome 4 of Drosophila melanogaster... on this gene, depending on the results ofthe project. Annotation is a critical process in the discovery of ... |
|||
|
Source: Sauerberg, Jim - Department of Mathematics and Computer Science, Saint Mary's College of California |
|||
|
Collection: Mathematics |
|||
| 80 | Genetic variation in putative regulatory loci controlling gene expression in breast cancer | ||
|
Summary: 22.2 EPHX2 8p21-p12 TXNRD2 22q11.21 PDGFRL 8p22-p21.3 PRKCABP 22q13.1 Table 2. Number of SNP... Genetic variation in putative regulatory loci controlling gene expression in breast cancer Vessela... unrelated patients with breast cancer. SNPs were selected from 203 candidate genes of the ... |
|||
|
Source: Sharan, Roded - School of Computer Science, Tel Aviv University |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 81 | Gene Ordering in Partitive Clustering using Microarray Expressions Shubhra Sankar Ray1 | ||
|
Summary: Gene Ordering in Partitive Clustering using Microarray Expressions Shubhra Sankar Ray1... }@isical.ac.in Abstract Motivation: A central step in the analysis of gene expression data is the identification of groups... of genes that exhibit similar expression patterns. Clustering and ordering the genes using ... |
|||
|
Source: Ray, Shubhra Sankar - Machine Intelligence Unit, Indian Statistical Institute |
|||
|
Collection: Computer Technologies and Information Sciences ; Biology and Medicine |
|||
| 82 | D3 receptor knockout mice have altered circadian gene expression patterns in spinal sympathetic preganglionic neurons | ||
|
Summary: D3 receptor knockout mice have altered circadian gene expression patterns in spinal sympathetic... biological regulators, and we have previously shown the circadian variation of gene expression... is implicated in the circadian-related disorder Restless Legs Syndrome (RLS). We compared the circadian gene |
|||
|
Source: Hochman, Shawn - Department of Physiology, Emory University |
|||
|
Collection: Biology and Medicine |
|||
| 83 | How To Filter Genes September 26, 2008 | ||
|
Summary: How To Filter Genes September 26, 2008 Introduction The genefilter package can be used to filter... (select) genes from a microarray experiment according to a wide variety of different filtering mechanisms... the Biobase package. This experiment has 26 samples, there are 500 genes and 3 covariates. The covariates |
|||
|
Source: Bain, Mike - School of Computer Science and Engineering, University of New South Wales |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 84 | 10/12/2007 9:20Rule-Breaker Genes Identified --Pennisi 2007 (1130): 1 --ScienceNOW Page 1 of 2http://sciencenow.sciencemag.org/cgi/content/full/2007/1130/1 | ||
|
Summary: 10/12/2007 9:20Rule-Breaker Genes Identified -- Pennisi 2007 (1130): 1 -- ScienceNOW Page 1 of 2... http://sciencenow.sciencemag.org/cgi/content/full/2007/1130/1 Rule-Breaker Genes Identified... chromosomes. In some cases, the copy of a gene inherited from one parent shuts down, leaving just the copy |
|||
|
Source: Hartemink, Alexander - Center for Bioinformatics and Computational Biology & Department of Computer Science, Duke University |
|||
|
Collection: Biotechnology ; Computer Technologies and Information Sciences |
|||
| 85 | Remarkable expansions of an X-linked reproductive homeobox gene cluster in rodent evolution | ||
|
Summary: Remarkable expansions of an X-linked reproductive homeobox gene cluster in rodent evolution Xiaoxia... of 12 X-linked homeobox genes in mice. The expression pattern of Rhox genes during postnatal testis... development corresponds to their chromosomal position, much like the colinear gene regulation of the Hox ... |
|||
|
Source: Zhang, Jianzhi - Department of Ecology and Evolutionary Biology, University of Michigan |
|||
|
Collection: Biology and Medicine |
|||
| 86 | Similarly Strong Purifying Selection Acts on Human Disease Genes of All Evolutionary Ages | ||
|
Summary: Similarly Strong Purifying Selection Acts on Human Disease Genes of All Evolutionary Ages James J... genes differ from the genes created in deep evolutionary past in many aspects. Here, we determined... the age of emergence and propensity for gene loss (PGL) of all human protein coding ... |
|||
|
Source: Borenstein, Elhanan - Department of Genome Sciences, University of Washington at Seattle; Petrov, Dmitri - Department of Biology, Stanford University |
|||
|
Collection: Biology and Medicine |
|||
| 87 | Blood . Author manuscript Gene expression profiling identifies emerging oncogenic pathways | ||
|
Summary: .3, and 8p22-p23). To identify candidate genes in the regions of CNA, we selected the genes with a Welch s T... Blood . Author manuscript Page /1 21 Gene expression profiling identifies emerging oncogenic... of NK/T-cell lymphoma, nasal-type (NKTCL) were subject to ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 88 | Gene expression profiling identifies emerging oncogenic pathways operating in extranodal NK/T-cell lymphoma, nasal-type | ||
|
Summary: , and 22q11.21) and four regions of losses (on 6q16-q25, 11q24-q25, 17p13.3, and 8p22-p23). To identify... 1 Gene expression profiling identifies emerging oncogenic pathways operating in extranodal NK... lines of NK/T-cell lymphoma, nasal-type (NKTCL) were subject to combined gene ... |
|||
|
Source: Ecole Polytechnique, Centre de mathématiques |
|||
|
Collection: Mathematics |
|||
| 89 | DOI: 10.1542/peds.113.5.e472 2004;113;e472-e486Pediatrics | ||
|
Summary: to mutations of the methyl-CpG-binding protein 2 (MeCP2) gene--the other PDD subtypes (autistic disor- der... of cases. Currently, diagnosable medical conditions, cytoge- netic abnormalities, and single-gene defects... rate in the general population but much lower than in single-gene diseases. Twin studies reported 60 |
|||
|
Source: Andrews, Anne M. - Huck Institutes of the Life Sciences, Pennsylvania State University |
|||
|
Collection: Biology and Medicine |
|||
| 90 | Correlated Discretized Expression Score: A Method for Identifying Gene Interaction Networks from Time Course Microarray | ||
|
Summary: Correlated Discretized Expression Score: A Method for Identifying Gene Interaction Networks from... -- One of the goals of genomic expression analysis is to construct gene interaction networks from... the expression of a regulator and its effect on the expression of its targets. By proposing gene expression |
|||
|
Source: Dai, Yang - Department of Bioengineering, University of Illinois at Chicago |
|||
|
Collection: Engineering ; Biotechnology |
|||
| 91 | Immunogenetics (2004) 56: 343354 DOI 10.1007/s00251-004-0703-0 | ||
|
Summary: Nei Genomic organization and evolutionary analysis of Ly49 genes encoding the rodent natural killer... cell receptors: rapid evolution by repeated gene duplication Received: 5 May 2004 / Accepted: 1 July... 2004 / Published online: 14 August 2004 # Springer-Verlag 2004 Abstract Ly49 genes regulate |
|||
|
Source: Nei, Masatoshi - Department of Biology, Pennsylvania State University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||
| 92 | Variation in gene copy number is seen among species, individuals and | ||
|
Summary: Variation in gene copy number is seen among species, individuals and cell types and makes... relationship between gene dosage and protein expression levels, function and disease. Springer and colleagues... asked a simple question: if you knock out one copy of a gene from a diploid genome, is the amount |
|||
|
Source: McLysaght, Aoife - Genetics Department, Trinity College, University of Dublin |
|||
|
Collection: Environmental Sciences and Ecology |
|||
| 93 | Frank Reidy Research Center for Bioelectrics "The cell biology of gene delivery: what happens to DNA | ||
|
Summary: Frank Reidy Research Center for Bioelectrics Seminar "The cell biology of gene delivery: what... Way (near Ted Constant Center) Dr. Dean's Research: Despite all of the hype regarding gene therapy... , at present, gene therapy is a dream due to insufficient levels of gene transfer and expression at desired |
|||
|
Source: Purdue University, Combinatorial Scientific Computing and Petascale Simulations Institute |
|||
|
Collection: Computer Technologies and Information Sciences |
|||
| 94 | Gene names: the approaching end of a century-long dilemma | ||
|
Summary: Gene names: the approaching end of a century-long dilemma The trouble started, of course... to choose an appropriate name for the first discovered mutant gene. The mutation caused the production... (homozygotes) in females. (The gene is sex-linked, that is carried on the X chromosome.) What should he call |
|||
|
Source: Courcelle, Justin - Department of Biology, Portland State University |
|||
|
Collection: Biology and Medicine |
|||
| 95 | Clusters of Co-expressed Genes in Mammalian Genomes Are Conserved by Natural Selection | ||
|
Summary: Clusters of Co-expressed Genes in Mammalian Genomes Are Conserved by Natural Selection Gregory A. C... Institute, University of Dublin, Trinity College, Dublin, Ireland Genes that belong to the same functional... studies have shown that gene order in eukaryotic genomes is not completely random, and that genes |
|||
|
Source: Wolfe, Kenneth H. - Genetics Department, Trinity College, University of Dublin |
|||
|
Collection: Biotechnology ; Environmental Sciences and Ecology |
|||
| 96 | Clusters of Co-expressed Genes in Mammalian Genomes Are Conserved by Natural Selection | ||
|
Summary: Clusters of Co-expressed Genes in Mammalian Genomes Are Conserved by Natural Selection Gregory A. C... Institute, University of Dublin, Trinity College, Dublin, Ireland Genes that belong to the same functional... studies have shown that gene order in eukaryotic genomes is not completely random, and that genes |
|||
|
Source: Dean, Matthew D. - Department of Ecology and Evolutionary Biology, University of Arizona; Nachman, Michael - Department of Ecology and Evolutionary Biology, University of Arizona |
|||
|
Collection: Biology and Medicine ; Environmental Sciences and Ecology |
|||
| 97 | BioMed Central Page 1 of 13 | ||
|
Summary: Research article Further understanding human disease genes by comparing with housekeeping genes and other genes... Abstract Background: Several studies have compared various features of heritable disease genes with other... so called non-disease genes, but they have yielded some ... |
|||
|
Source: Chen, Ting - Department of Biological Sciences, University of Southern California |
|||
|
Collection: Biotechnology ; Biology and Medicine ; Mathematics |
|||
| 98 | PRENATAL DIAGNOSIS Prenat. Diagn. 19: 863867 (1999) | ||
|
Summary: 223. Huang W-Y, Heng HHQ, Liew C-C. 1996. Assignment of the human GATA4 gene to 8p22 |
|||
|
Source: Bhatia, Sangeeta - Department of Electrical Engineering and Computer Science, Massachusetts Institute of Technology (MIT) |
|||
|
Collection: Biotechnology ; Biology and Medicine |
|||
| 99 | Design of a Clinical Microarray Chip J. Jger and R. Spang | ||
|
Summary: of as many genes as possible. We study the problem of how many samples should be analyzed before moving from... diagnostic chip? Gene subset selection New compact diagnostic chip Experimental design Diagnostic signature... and gene selection Intensity Frequency Questions Normal scenario: Rank all genes based ... |
|||
|
Source: Spang, Rainer - Computational Molecular Biology Group, Max-Planck-Institut für molekulare Genetik |
|||
|
Collection: Computer Technologies and Information Sciences ; Biotechnology ; Biology and Medicine |
|||
| 100 | Comparative evolutionary analysis of olfactory receptor gene clusters between humans and mice | ||
|
Summary: Comparative evolutionary analysis of olfactory receptor gene clusters between humans and mice... Received by T. Gojobori Abstract Olfactory receptor (OR) genes form the largest multigene family... in mammalian genomes. Humans have ~800 OR genes, but N50% of them are pseudogenes. By contrast, mice have ~1400 |
|||
|
Source: Nei, Masatoshi - Department of Biology, Pennsylvania State University |
|||
|
Collection: Environmental Sciences and Ecology ; Biology and Medicine |
|||